PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf11386g00002.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 174aa MW: 19792.1 Da PI: 6.5155 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 132.7 | 1.1e-41 | 24 | 98 | 23 | 97 |
NF-YB 23 anakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 +n+kiskdaketvqecvsefisfvt+easdkcqrekrktingdd++wa++ lGf++yv+plk+yl+kyrelegek Niben101Scf11386g00002.1 24 GNGKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDIIWAIGVLGFNEYVNPLKQYLNKYRELEGEK 98 69**********************************************************************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF00808 | 9.4E-20 | 20 | 72 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
SuperFamily | SSF47113 | 9.89E-31 | 20 | 110 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 6.6E-38 | 25 | 113 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 3.3E-18 | 36 | 54 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 39 | 55 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 3.3E-18 | 55 | 73 | No hit | No description |
PRINTS | PR00615 | 3.3E-18 | 74 | 92 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 174 aa Download sequence Send to blast |
MNWRETKISL FLLRLRASLR DETGNGKISK DAKETVQECV SEFISFVTGE ASDKCQREKR 60 KTINGDDIIW AIGVLGFNEY VNPLKQYLNK YRELEGEKLS VPNKQQQQQQ LHDHAHSPSL 120 PNYNSVYNSP SGLGLPQPSF VSTDQSFPLP LISQNSIQSQ LSQQEQQIDS VGHW |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_B | 8e-32 | 1 | 93 | 1 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 8e-32 | 1 | 93 | 1 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016488048.1 | 1e-107 | PREDICTED: nuclear transcription factor Y subunit B-3-like | ||||
Swissprot | Q9SIT9 | 5e-44 | NFYB7_ARATH; Nuclear transcription factor Y subunit B-7 | ||||
TrEMBL | A0A1S4BGP4 | 1e-106 | A0A1S4BGP4_TOBAC; nuclear transcription factor Y subunit B-3-like | ||||
STRING | XP_009598349.1 | 1e-106 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G13570.1 | 2e-43 | nuclear factor Y, subunit B7 |
Publications ? help Back to Top | |||
---|---|---|---|
|