PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf11224g00008.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 125aa MW: 14700.1 Da PI: 11.1346 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 83.3 | 3.3e-26 | 42 | 88 | 30 | 76 |
-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS SBP 30 apvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 ap vl++gl+qrfCqqCsrfhe+sefD +krsCrr+La+hnerrrk+ Niben101Scf11224g00008.1 42 APIVLLAGLRQRFCQQCSRFHEVSEFDGTKRSCRRHLAGHNERRRKT 88 789******************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51141 | 17.854 | 1 | 88 | IPR004333 | Transcription factor, SBP-box |
Gene3D | G3DSA:4.10.1100.10 | 2.1E-16 | 40 | 75 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.06E-21 | 42 | 90 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 4.7E-20 | 42 | 87 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 125 aa Download sequence Send to blast |
MLKRKKGQIV KDPVVKWRNV GFICVLQTST TKDINFVNSM LAPIVLLAGL RQRFCQQCSR 60 FHEVSEFDGT KRSCRRHLAG HNERRRKTPL AIKLEDNQCR QMNEENRQQK TLTNRNASFK 120 TYHIL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 4e-18 | 42 | 87 | 39 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019249702.1 | 1e-48 | PREDICTED: squamosa promoter-binding protein 1-like | ||||
Swissprot | Q6Z461 | 1e-21 | SPL13_ORYSJ; Squamosa promoter-binding-like protein 13 | ||||
TrEMBL | A0A1S4AZ43 | 2e-46 | A0A1S4AZ43_TOBAC; squamosa promoter-binding-like protein 3 | ||||
TrEMBL | A0A1U7XQY5 | 2e-46 | A0A1U7XQY5_NICSY; squamosa promoter-binding-like protein 3 | ||||
STRING | XP_009788885.1 | 4e-47 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA749 | 24 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G53160.2 | 9e-22 | squamosa promoter binding protein-like 4 |