PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf08791g03011.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 136aa MW: 15651.3 Da PI: 7.4377 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 131.7 | 2.5e-41 | 52 | 127 | 2 | 77 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 Cqve+C+ad+++a+ yh rhkvCe+hskapvvl+sg++qrfCqqCsrfh+ efDe+krsCrrrLa+hnerrrk++ Niben101Scf08791g03011.1 52 CQVEQCTADMADAQPYHCRHKVCEFHSKAPVVLISGIQQRFCQQCSRFHQPPEFDEAKRSCRRRLAGHNERRRKTS 127 **************************************************************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PIRSF | PIRSF037575 | 7.4E-56 | 1 | 136 | IPR017238 | Squamosa promoter-binding protein |
Gene3D | G3DSA:4.10.1100.10 | 2.7E-33 | 45 | 113 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 31.197 | 49 | 126 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 2.35E-38 | 50 | 130 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.3E-31 | 52 | 125 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 136 aa Download sequence Send to blast |
MEDNKWEGKR SMNEAEEEEE EHENAEEDNK RKRALTLSGR KLSGGGPALP SCQVEQCTAD 60 MADAQPYHCR HKVCEFHSKA PVVLISGIQQ RFCQQCSRFH QPPEFDEAKR SCRRRLAGHN 120 ERRRKTSYDS RGESSS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 8e-38 | 43 | 125 | 2 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019233399.1 | 2e-78 | PREDICTED: squamosa promoter-binding protein 1-like | ||||
Swissprot | Q38741 | 1e-52 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
TrEMBL | A0A1J6KRD2 | 6e-77 | A0A1J6KRD2_NICAT; Squamosa promoter-binding-like protein | ||||
STRING | XP_009602313.1 | 1e-75 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA749 | 24 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33810.1 | 1e-42 | squamosa promoter binding protein-like 3 |
Publications ? help Back to Top | |||
---|---|---|---|
|