PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf08172g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | HB-other | ||||||||
Protein Properties | Length: 88aa MW: 11069.8 Da PI: 10.3074 | ||||||||
Description | HB-other family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 32.7 | 1.3e-10 | 12 | 51 | 17 | 56 |
HHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 17 elFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 ++F+++++p ++r+eL k+lg ++ q+k+WF N+ ++ k Niben101Scf08172g00001.1 12 KFFKECPHPYDKQRKELGKRLGFDTLQIKFWFENKHTQIK 51 79********************************988766 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 5.56E-9 | 10 | 54 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 3.19E-5 | 12 | 54 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 6.3E-10 | 12 | 60 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 10.479 | 12 | 53 | IPR001356 | Homeobox domain |
Pfam | PF00046 | 3.2E-8 | 12 | 51 | IPR001356 | Homeobox domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 88 aa Download sequence Send to blast |
LLLQLINWSF YKFFKECPHP YDKQRKELGK RLGFDTLQIK FWFENKHTQI KAHHERHENT 60 HVRWKNEKYC AENIYKRDRR KGIIVFSY |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018628742.1 | 2e-29 | PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like isoform X3 | ||||
Swissprot | Q94C37 | 3e-25 | HDG2_ARATH; Homeobox-leucine zipper protein HDG2 | ||||
TrEMBL | A0A1S4D6C3 | 1e-27 | A0A1S4D6C3_TOBAC; homeobox-leucine zipper protein MERISTEM L1-like | ||||
TrEMBL | A0A1U7Y2Y7 | 1e-27 | A0A1U7Y2Y7_NICSY; homeobox-leucine zipper protein MERISTEM L1-like | ||||
STRING | XP_009793614.1 | 2e-28 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA13886 | 8 | 14 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G05230.3 | 1e-27 | homeodomain GLABROUS 2 |