PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf08137g03011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 262aa    MW: 30673 Da    PI: 8.0844
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf08137g03011.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-18449147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                              rg W + Ede+l ++v+++G+++W++Ia+ ++ gR++k+c++rw++ 
  Niben101Scf08137g03011.1  4 RGHWRPHEDEKLRELVAKYGPHNWNAIAENLQ-GRSGKSCRLRWYNQ 49
                              899*****************************.************96 PP

2Myb_DNA-binding54.33e-175699146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                              r ++T+eE+e+l+  ++ +G++ W+ Iar ++ gRt++ +k++w+ 
  Niben101Scf08137g03011.1 56 RSPFTEEEEERLLASHRIHGNR-WAIIARLFP-GRTDNAVKNHWHV 99
                              789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.281154IPR017930Myb domain
SMARTSM007171.3E-16352IPR001005SANT/Myb domain
SuperFamilySSF466891.8E-29497IPR009057Homeodomain-like
PfamPF002491.0E-17450IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-27557IPR009057Homeodomain-like
CDDcd001671.36E-14748No hitNo description
SMARTSM007172.4E-1555103IPR001005SANT/Myb domain
PROSITE profilePS5129421.5555105IPR017930Myb domain
PfamPF002494.9E-145698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.9E-2158104IPR009057Homeodomain-like
CDDcd001674.28E-115898No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MCSRGHWRPH EDEKLRELVA KYGPHNWNAI AENLQGRSGK SCRLRWYNQL DPRINRSPFT  60
EEEEERLLAS HRIHGNRWAI IARLFPGRTD NAVKNHWHVI MSRRCRERSK IYSMRNIAAA  120
PKSTSQQDMN TTSPSDHLHD DNNIHNIMRK RSSNISIDHH HQLLERFNYY PFTNNNSLYP  180
KELHFNHLPA HHLKMDEGKN NEAVECYDFL RVNTGSNKSE VVEDNITRRD AEEVEQEAGD  240
NNSLQSKAPV RFIDFLSVGD SS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-3441057108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:23781226}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19674407, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:22197883}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009770258.10.0PREDICTED: transcriptional activator Myb-like
RefseqXP_016446234.10.0PREDICTED: transcriptional activator Myb-like
SwissprotQ6R0C44e-77MYB52_ARATH; Transcription factor MYB52
TrEMBLA0A1S3Y2730.0A0A1S3Y273_TOBAC; transcriptional activator Myb-like
TrEMBLA0A1U7VV580.0A0A1U7VV58_NICSY; transcriptional activator Myb-like
STRINGXP_009770258.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.11e-79myb domain protein 52
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Cassan-Wang H, et al.
    Identification of novel transcription factors regulating secondary cell wall formation in Arabidopsis.
    Front Plant Sci, 2013. 4: p. 189
    [PMID:23781226]
  3. Shi D, et al.
    MYB52 Negatively Regulates Pectin Demethylesterification in Seed Coat Mucilage.
    Plant Physiol., 2018. 176(4): p. 2737-2749
    [PMID:29440562]