PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Niben101Scf07648g01024.1

Organism

Nicotiana benthamiana

Taxonomic ID

4100

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

M-type_MADS

Protein Properties

Length: 142aa MW: 16276.8 Da PI: 10.4835

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Niben101Scf07648g01024.1	genome	BTI	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	68.4	6.9e-22	16	63	2	49
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 +ie k qvtfskRr g++KKA+EL++LC++e+a+i+fs+ k++ + Niben101Scf07648g01024.1 16 KIEVKNHLQVTFSKRRSGLFKKASELCTLCGVEIAIIVFSPARKVFSF 63 58888899**********************************999887 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	23.703	7	67	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.6E-30	7	66	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	3.79E-27	8	89	IPR002100	Transcription factor, MADS-box
CDD	cd00265	7.64E-33	8	81	No hit	No description
PRINTS	PR00404	5.3E-18	9	29	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	4.8E-24	16	63	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.3E-18	29	44	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.3E-18	44	65	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 142 aa Download sequence Send to blast
MAKKPSIGRQ KIKIAKIEVK NHLQVTFSKR RSGLFKKASE LCTLCGVEIA IIVFSPARKV 60 FSFGHPNVES IVDRFLSRNH NPVSNSSLHL VEAHRNASVR ELNLQLTQIL AELEVEKKRG 120 ESFDQMRKTS ESQYWWEAPI DF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3kov_A	1e-15	8	93	1	86	Myocyte-specific enhancer factor 2A
3kov_B	1e-15	8	93	1	86	Myocyte-specific enhancer factor 2A
3kov_I	1e-15	8	93	1	86	Myocyte-specific enhancer factor 2A
3kov_J	1e-15	8	93	1	86	Myocyte-specific enhancer factor 2A
3p57_A	1e-15	8	93	1	86	Myocyte-specific enhancer factor 2A
3p57_B	1e-15	8	93	1	86	Myocyte-specific enhancer factor 2A
3p57_C	1e-15	8	93	1	86	Myocyte-specific enhancer factor 2A
3p57_D	1e-15	8	93	1	86	Myocyte-specific enhancer factor 2A
3p57_I	1e-15	8	93	1	86	Myocyte-specific enhancer factor 2A
3p57_J	1e-15	8	93	1	86	Myocyte-specific enhancer factor 2A
5f28_A	1e-15	7	93	1	87	MEF2C
5f28_B	1e-15	7	93	1	87	MEF2C
5f28_C	1e-15	7	93	1	87	MEF2C
5f28_D	1e-15	7	93	1	87	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269\|PubMed:18334668}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019234247.1	5e-98	PREDICTED: agamous-like MADS-box protein AGL62
Swissprot	Q9FKK2	9e-50	AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBL	A0A1J6K9V7	1e-96	A0A1J6K9V7_NICAT; Agamous-like mads-box protein agl62
STRING	XP_009628464.1	4e-96	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA204	24	223

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60440.1	4e-52	AGAMOUS-like 62

Publications ? help Back to Top
Xu W, et al. Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds. Plant Cell, 2016. 28(6): p. 1343-60 [PMID:27233529] Figueiredo DD,Batista RA,Roszak PJ,Köhler C Auxin production couples endosperm development to fertilization. Nat Plants, 2015. 1: p. 15184 [PMID:27251719] Figueiredo DD,Batista RA,Roszak PJ,Hennig L,Köhler C Auxin production in the endosperm drives seed coat development in Arabidopsis. Elife, 2017. [PMID:27848912] Fiume E,Coen O,Xu W,Lepiniec L,Magnani E Growth of the Arabidopsis sub-epidermal integument cell layers might require an endosperm signal. Plant Signal Behav, 2017. 12(8): p. e1339000 [PMID:28613109] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]