PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf06616g03009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 319aa    MW: 36649.6 Da    PI: 7.4602
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf06616g03009.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.4e-182572148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                              rg+WT eEd  l++ ++ +G g+W++ ar+ g++Rt+k+c++rw++yl
  Niben101Scf06616g03009.1 25 RGPWTVEEDFTLINFIAHHGEGRWNSLARCAGLKRTGKSCRLRWLNYL 72
                              89********************************************97 PP

2Myb_DNA-binding51.32.7e-1678121146
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
           Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                               rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Niben101Scf06616g03009.1  78 RGNITLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 121
                               7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.7442072IPR017930Myb domain
SuperFamilySSF466891.2E-3022119IPR009057Homeodomain-like
SMARTSM007175.1E-152474IPR001005SANT/Myb domain
PfamPF002495.0E-162572IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.9E-222679IPR009057Homeodomain-like
CDDcd001673.43E-112772No hitNo description
PROSITE profilePS5129423.24673127IPR017930Myb domain
SMARTSM007171.3E-1477125IPR001005SANT/Myb domain
PfamPF002495.4E-1578121IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.0E-2380126IPR009057Homeodomain-like
CDDcd001676.47E-798121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MDHNKIKVGF KNNNQEKEED LDLRRGPWTV EEDFTLINFI AHHGEGRWNS LARCAGLKRT  60
GKSCRLRWLN YLRPDVRRGN ITLEEQLLIL ELHSRWGNRW SKIAQHLPGR TDNEIKNYWR  120
TRVQKHAKQL KCDVNSKQFK DTMKYLWMPR LVERIQAAAA ATTSSGTTVV SSSTTTTYIQ  180
NQSIQQPLPN ISTMSEVNVP VQLANNVDKT NSLNYSSAIS TLENSSATTS SDNSSSDLTD  240
CCYNFPINQS TNQNYSQVNQ TNQVCYGDQY LTSPTGYFNP GYFQALDQQN FQLIDGEYGS  300
DNSWNIEDIW FLQQQFSNM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-24221251103MYB PROTO-ONCOGENE PROTEIN
1h8a_C1e-242211924120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salt (NaCl). {ECO:0000269|PubMed:16463103}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009621085.10.0PREDICTED: transcription factor MYB108-like
RefseqXP_016479574.10.0PREDICTED: transcription factor MYB108-like
SwissprotQ9FGY31e-93MYB78_ARATH; Transcription factor MYB78
TrEMBLA0A1S4ASB20.0A0A1S4ASB2_TOBAC; transcription factor MYB108-like
STRINGXP_009621085.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13972375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.12e-86myb domain protein 78
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]