PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf06588g01002.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 94aa MW: 10688.3 Da PI: 9.8099 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 61.6 | 2.4e-19 | 9 | 57 | 2 | 51 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkv 51 ppGfrFhPtdeelvv+yLkkkv++ +l++ ++i+ev++yk++Pw+Lp+++ Niben101Scf06588g01002.1 9 PPGFRFHPTDEELVVYYLKKKVASAPLPV-TIIAEVNLYKFDPWELPSQF 57 8****************************.89**************9544 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.7E-27 | 6 | 85 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 20.443 | 8 | 94 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.9E-9 | 9 | 51 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 94 aa Download sequence Send to blast |
MSGSNHLQPP GFRFHPTDEE LVVYYLKKKV ASAPLPVTII AEVNLYKFDP WELPSQFGGA 60 RMGKPPKGIK SNWVMHEYRL VDNNTSLTNK CSLR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 5e-21 | 9 | 80 | 16 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor of the NAC family associated with male fertility. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019259450.1 | 4e-43 | PREDICTED: NAC transcription factor 25-like | ||||
Swissprot | A2YMR0 | 6e-31 | NAC10_ORYSI; NAC transcription factor ONAC010 | ||||
TrEMBL | A0A314LDU5 | 9e-42 | A0A314LDU5_NICAT; Nac transcription factor 25 | ||||
STRING | XP_009780447.1 | 3e-42 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA134 | 24 | 297 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G61110.1 | 5e-30 | NAC domain containing protein 25 |