PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf05519g02018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 470aa    MW: 53149 Da    PI: 6.5124
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf05519g02018.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS473.11.5e-144474671374
                      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                               l++lLl+cA++v++g+le+a+ +L ++s+lasp+gd+mqR+a+yf+eALa r++rs++++ykal++++ s   +se + + k+f+
  Niben101Scf05519g02018.1  47 LIHLLLTCANHVAAGNLENANIALDQISQLASPNGDTMQRIASYFAEALADRILRSWPGIYKALHSTKLS--IVSEDILVKKMFF 129
                               689*************************************************************999998..69*********** PP

                      GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAe 170
                               e +P+lk++ l++NqaI ea+ege++vHi+D+++s++lQW aLlq L++Rpegpp+lRiTgv++    +ke le++++ L++ Ae
  Niben101Scf05519g02018.1 130 EYFPFLKVASLITNQAIIEAMEGEKMVHIVDLNASEPLQWRALLQDLSARPEGPPHLRITGVHQ----QKEVLEQIAHVLTEEAE 210
                               ****************************************************************....9**************** PP

                      GRAS 171 elgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrll......................................... 214
                               +l++pf+f+  v+++le+l++e+Lrvk+gEala+++v+qlh+ll                                         
  Niben101Scf05519g02018.1 211 KLDIPFQFHQ-VVSKLENLDVEKLRVKTGEALAISSVMQLHTLLahedehqkksplglkhmnglhlqrallnqntlgdlleketa 294
                               **********.799*********************************************************************** PP

                      GRAS 215 ..............desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikv 285
                                              ++++ + + d +L+++++lsPkv+vv+eq+++hn+++++er++e+l++y+alfd+le +l r+s er kv
  Niben101Scf05519g02018.1 295 nvfspgnesassspLSPTA-SAKMDGFLHALWGLSPKVMVVTEQDSNHNGSTLMERLSESLYFYAALFDCLEFTLQRTSLERLKV 378
                               *******999876422222.225899*********************************************************** PP

                      GRAS 286 ErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                               E++l+g+ei+n+vaceg er+erhe+l kW +r++ aGFk+vpls++a+ qa++ll+ ++ +gy+++ee+g++v++W+dr+L+sv
  Niben101Scf05519g02018.1 379 EKMLFGEEIKNIVACEGVERKERHEKLDKWFQRFDGAGFKNVPLSYYAMLQARRLLQSYSCEGYKIKEENGCVVICWQDRALFSV 463
                               ************************************************************************************* PP

                      GRAS 371 SaWr 374
                               SaWr
  Niben101Scf05519g02018.1 464 SAWR 467
                               ***8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.21721447IPR005202Transcription factor GRAS
PfamPF035145.2E-14247467IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MLRDDGSSSV TSSSPLQNFP MMSLSPSFNS PYNWLKELKS EERGLYLIHL LLTCANHVAA  60
GNLENANIAL DQISQLASPN GDTMQRIASY FAEALADRIL RSWPGIYKAL HSTKLSIVSE  120
DILVKKMFFE YFPFLKVASL ITNQAIIEAM EGEKMVHIVD LNASEPLQWR ALLQDLSARP  180
EGPPHLRITG VHQQKEVLEQ IAHVLTEEAE KLDIPFQFHQ VVSKLENLDV EKLRVKTGEA  240
LAISSVMQLH TLLAHEDEHQ KKSPLGLKHM NGLHLQRALL NQNTLGDLLE KETANVFSPG  300
NESASSSPLS PTASAKMDGF LHALWGLSPK VMVVTEQDSN HNGSTLMERL SESLYFYAAL  360
FDCLEFTLQR TSLERLKVEK MLFGEEIKNI VACEGVERKE RHEKLDKWFQ RFDGAGFKNV  420
PLSYYAMLQA RRLLQSYSCE GYKIKEENGC VVICWQDRAL FSVSAWRCRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A9e-43304691380Protein SCARECROW
5b3h_D9e-43304691380Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016505834.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A1S4CXT40.0A0A1S4CXT4_TOBAC; scarecrow-like protein 3
STRINGXP_009793219.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]