PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf04993g06012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 300aa    MW: 33363.9 Da    PI: 6.0469
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf04993g06012.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS48.81.2e-1579151173
                      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn 73 
                               l+elL +cAeavs+ d + a+ l++ l++++s +g+pm+Rl ay++e+L+arl++s+s +yk+l+++e ++++
  Niben101Scf04993g06012.1  79 LKELLDACAEAVSNADISTAEVLMNILEKRVSVSGEPMERLSAYVLEGLRARLLSSGSIIYKKLKCKEPTSSE 151
                               578999**************************************************************99654 PP

2GRAS135.65.4e-42182300186304
                      GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                                 +++le+Lrv++gEalaVn+ ++lh+++desvs+ ++rd++L+lvkslsPk+v++veqe+++n+++Fl rf ++l+yy a+f+s
  Niben101Scf04993g06012.1 182 GCEVQLENLRVRHGEALAVNFPYMLHHMPDESVSTINHRDRLLRLVKSLSPKIVTLVEQESNTNTAPFLPRFHDTLDYYIAMFES 266
                               56899******************************************************************************** PP

                      GRAS 271 leaklpreseerikvErellgreivnvvacegae 304
                               ++a  pr++++ri+ E+++++r+ivn++acega+
  Niben101Scf04993g06012.1 267 IDAARPRDDKQRISAEKHCVARDIVNIIACEGAD 300
                               *******************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098520.3571300IPR005202Transcription factor GRAS
PfamPF035144.3E-1379151IPR005202Transcription factor GRAS
PfamPF035141.9E-39182300IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MSDQHHSSDN NTCGSPFSGC SGVDDGYLKH VLRELENKLL GPESDTDDSC SCSFNIVVSK  60
PSSLTRWNRV LDMAPSLSLK ELLDACAEAV SNADISTAEV LMNILEKRVS VSGEPMERLS  120
AYVLEGLRAR LLSSGSIIYK KLKCKEPTSS ELLSYRIGKS VDVPPPRSLS SAWWAPFVRI  180
TGCEVQLENL RVRHGEALAV NFPYMLHHMP DESVSTINHR DRLLRLVKSL SPKIVTLVEQ  240
ESNTNTAPFL PRFHDTLDYY IAMFESIDAA RPRDDKQRIS AEKHCVARDI VNIIACEGAD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-16184300189303GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a positive regulator of continuous red light signals downstream of phytochrome B (phyB). Required for the regulation of hypocotyl elongation during de-etiolation. May be required to modulate phytochrome A (phyA) signal transduction in a phyB-independent way. {ECO:0000269|PubMed:16680434}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By osmotic and cold stresses, and UV-A/B. {ECO:0000269|PubMed:16680434}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016487801.11e-165PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M53e-59SCL13_ARATH; Scarecrow-like protein 13
TrEMBLA0A1S4BG191e-164A0A1S4BG19_TOBAC; scarecrow-like protein 13
STRINGXP_009773976.11e-162(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.11e-61SCARECROW-like 13