PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Niben101Scf04364g01009.1

Organism

Nicotiana benthamiana

Taxonomic ID

4100

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

ZF-HD

Protein Properties

Length: 92aa MW: 10296.4 Da PI: 6.0772

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Niben101Scf04364g01009.1	genome	BTI	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	108.9	2.9e-34	27	83	3	60
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +vrY+eC+kNhAas+Gg+avDGC+Efmps gee t+ al+CaACgCHRnFHRreve+e Niben101Scf04364g01009.1 27 TVRYRECQKNHAASVGGYAVDGCREFMPS-GEEETPGALTCAACGCHRNFHRREVETE 83 79************************9.8888******************9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	9.0E-26	1	91	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	4.1E-32	28	80	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	1.2E-29	29	80	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	26.135	30	79	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 92 aa Download sequence Send to blast
MTKRHVILMK DDFSDDNSTN SSFTIRTVRY RECQKNHAAS VGGYAVDGCR EFMPSGEEET 60 PGALTCAACG CHRNFHRREV ETEVACDCSF PN

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016453067.1	4e-60	PREDICTED: mini zinc finger protein 2-like
Refseq	XP_016453079.1	4e-60	PREDICTED: mini zinc finger protein 2-like
Refseq	XP_016453087.1	4e-60	PREDICTED: mini zinc finger protein 2-like
Swissprot	Q9LJW5	4e-36	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	A0A1S3YLG5	1e-58	A0A1S3YLG5_TOBAC; mini zinc finger protein 2-like
STRING	XP_009596464.1	2e-58	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1105	24	86

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	6e-36	mini zinc finger 2

Publications ? help Back to Top
Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]