PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf03949g07018.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | Whirly | ||||||||
Protein Properties | Length: 143aa MW: 16165.3 Da PI: 6.5243 | ||||||||
Description | Whirly family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Whirly | 155.8 | 1.4e-48 | 1 | 105 | 35 | 139 |
Whirly 35 llelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlpdGsGlfvnlsvtnslvkgn 119 +l++ ++++erkydWek+q falsatev++l++++++++ceffhdp++ +sn+G+vrk+l+ +P +dGsG+fv+lsv n+ +k+n Niben101Scf03949g07018.1 1 MLTFWPSVGERKYDWEKRQLFALSATEVGSLISIGTRDTCEFFHDPSMLSSNAGQVRKSLSFKPNADGSGYFVSLSVVNNNLKTN 85 89*********************************************************************************** PP Whirly 120 esfsvPvskaefavlrsllv 139 ++f+vPv+ aefav+r++++ Niben101Scf03949g07018.1 86 DRFTVPVTTAEFAVMRTAFS 105 *****************995 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF54447 | 3.14E-46 | 1 | 136 | IPR009044 | ssDNA-binding transcriptional regulator |
Gene3D | G3DSA:2.30.31.10 | 2.7E-53 | 1 | 124 | IPR009044 | ssDNA-binding transcriptional regulator |
Pfam | PF08536 | 5.7E-45 | 1 | 102 | IPR013742 | Plant transcription factor |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
MLTFWPSVGE RKYDWEKRQL FALSATEVGS LISIGTRDTC EFFHDPSMLS SNAGQVRKSL 60 SFKPNADGSG YFVSLSVVNN NLKTNDRFTV PVTTAEFAVM RTAFSFALPH IMGWDRFINQ 120 PLESISQSSS KVVPQLMETE WDR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3n1h_A | 4e-84 | 1 | 123 | 50 | 172 | StWhy2 |
3n1i_A | 4e-84 | 1 | 123 | 50 | 172 | protein StWhy2 |
3n1j_A | 4e-84 | 1 | 123 | 50 | 172 | Protein StWhy2 |
3n1k_A | 4e-84 | 1 | 123 | 50 | 172 | protein StWhy2 |
3n1l_A | 4e-84 | 1 | 123 | 50 | 172 | protein StWhy2 |
3r9y_A | 4e-84 | 1 | 123 | 50 | 172 | Why2 protein |
3r9z_A | 4e-84 | 1 | 123 | 50 | 172 | Why2 protein |
3ra0_A | 4e-84 | 1 | 123 | 50 | 172 | Why2 protein |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Single-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009598359.1 | 2e-99 | PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X5 | ||||
Refseq | XP_016508347.1 | 2e-99 | PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial-like isoform X5 | ||||
Swissprot | D9J034 | 7e-96 | WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial | ||||
TrEMBL | A0A1S4D4L1 | 4e-98 | A0A1S4D4L1_TOBAC; single-stranded DNA-bindig protein WHY2, mitochondrial-like isoform X5 | ||||
STRING | XP_009598355.1 | 8e-99 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA9782 | 22 | 28 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G71260.1 | 7e-70 | WHIRLY 2 |