PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf03860g03001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 255aa    MW: 29459.9 Da    PI: 6.7315
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf03860g03001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.93.1e-103075346
                              SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
           Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                              +WTteE +++ da +++ ++   +W  +a++++ g+t ++++  ++ 
  Niben101Scf03860g03001.1 30 KWTTEENKRFEDALALFDKEtpdRWYNVAAMIP-GKTVNDVIKQYRE 75
                              8*****************99*************.********99986 PP

2Myb_DNA-binding25.33.5e-081251601247
                               HHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding  12 lvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               ++ + k++G+g+W+ I+r   ++Rt+ q+ s+ qky
  Niben101Scf03860g03001.1 125 FLLGLKKYGKGDWRNISRNYVTTRTPTQVASHAQKY 160
                               67789******************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.5972377IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.607.4E-42677IPR009057Homeodomain-like
SMARTSM007172.8E-92779IPR001005SANT/Myb domain
SuperFamilySSF466891.35E-112983IPR009057Homeodomain-like
PfamPF002493.1E-82976IPR001005SANT/Myb domain
CDDcd001672.91E-73077No hitNo description
SMARTSM007170.24117163IPR001005SANT/Myb domain
CDDcd001672.53E-5124161No hitNo description
TIGRFAMsTIGR015579.9E-11124164IPR006447Myb domain, plants
SuperFamilySSF466891.05E-9124164IPR009057Homeodomain-like
PfamPF002499.0E-6125160IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-5125160IPR009057Homeodomain-like
PROSITE profilePS500904.588129161IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MSSEIEFLSP TTTYLRNSNW LFEENKGTTK WTTEENKRFE DALALFDKET PDRWYNVAAM  60
IPGKTVNDVI KQYRELVEDI SDIEAGLVPI PGYTTSTNSF TLEWINHDQE GDFHYLNKRF  120
YGPQFLLGLK KYGKGDWRNI SRNYVTTRTP TQVASHAQKY FIRQLSGGKD KRRSSIHDIT  180
TVNLTEMKSP SPENHISSIY PHKSAPSPQE QGIYEYNLPN QEADIAFRTY GLKLHENGMH  240
SVILQGLQFG QYNTM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-1831961176RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019238009.11e-179PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H78e-77DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A1J6K0221e-177A0A1J6K022_NICAT; Transcription factor myb1r1
STRINGXP_009802192.11e-175(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.13e-86MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]