PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf03599g01007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 754aa    MW: 82863.6 Da    PI: 5.6137
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf03599g01007.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS326.74.6e-1003927532374
                      GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfse 86 
                               +++L+++Ae v++ +  laq +Larl+++ sp g+p+ R+a+y +eAL+  l+ ++++l ++  ps+++  n + ++ a+k fse
  Niben101Scf03599g01007.1 392 IDQLFKAAELVQTVNPVLAQGILARLNHQLSPIGKPFYRAAFYCKEALQLLLHTNTNNLNNSSIPSSSP-FNLIFKIGAYKSFSE 475
                               689***************************************************999998877666654.78************* PP

                      GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAee 171
                               +sP+ +f+++t+Nqa+le ++g er+H++Dfdi++G QW++L+q+La R++g+p+l+iT+++sp+++++ el  t+e L +fA+e
  Niben101Scf03599g01007.1 476 ISPVAQFANFTCNQALLEVLDGFERIHVVDFDIGYGRQWASLMQELALRSGGAPTLKITALASPSTHDQLELGLTRESLIHFANE 560
                               ************************************************************************************* PP

                      GRAS 172 lgvpfefnvlvakrledleleeL..rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFl 254
                               ++++fef++l  ++l++   ++L   v+++Ea+aVnl ++    +  ++sl+     vL++vk+lsP++vv v++ +d+++ +F 
  Niben101Scf03599g01007.1 561 INMEFEFEILSIDSLNST-SWSLppLVSENEAIAVNLPISSLASY--QLSLPL----VLRFVKQLSPRIVVSVDKGCDRTDLPFP 638
                               *********977766665.4555334788**********766666..566655....**************************** PP

                      GRAS 255 erflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakl 339
                               +++++ l+ ys l++sl+a    + ++ +k+Er+ll+++i+ +v+ + ++     e+ ++Wr+ + ++G++p+pls+++++qa +
  Niben101Scf03599g01007.1 639 NHVIQILQSYSNLLESLDAV-NVNFDALQKIERFLLQPRIERIVMSRYRS----PEKTQHWRALFLSSGLSPLPLSNFTESQAVC 718
                               *****************665.3466999******************9999....9****************************** PP

                      GRAS 340 llrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                               ++++++++g++ve+++ slvl W++++L+s+SaWr
  Niben101Scf03599g01007.1 719 VVKRTPVRGFHVEKRQSSLVLWWQRKELISASAWR 753
                               **********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.87365733IPR005202Transcription factor GRAS
PfamPF035141.6E-97392753IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 754 aa     Download sequence    Send to blast
MPLPFDFEGK GMLDLDVVLN KNSILNSWNY NSKESCYLVN SPSAVLDIIR SPRPVTSSST  60
LSSSLGGGGG GGGGTASTDT AGAVSANPSS KWQQQQQQQD NTTATSSNVG GAAAESELQQ  120
VAAATEGKKC VMEEWEGGLS ESVMASPCQE QSILGWIMGD VDDPSMSNLN KVLQVSGPMD  180
YEFNAGFGVV DQGFGVDQIG TSSFMPAINS SSVSSFSPPT TGMNSDKIGL LSNIPTNLSQ  240
NQIFPSFSNN LGPVSFSQTQ QQQQPFDSTD LKPQSFHSQF LINQHQTQIP QNPSFLLPLP  300
FAQQEQNLVL PPKAKRHNPG TLEQQGSQIS QELFIDAGQQ QPTASHQLQL LPHFRPAGPM  360
GTKPKMVGEE MGQFHQLQLQ QQQQQQQQQA IIDQLFKAAE LVQTVNPVLA QGILARLNHQ  420
LSPIGKPFYR AAFYCKEALQ LLLHTNTNNL NNSSIPSSSP FNLIFKIGAY KSFSEISPVA  480
QFANFTCNQA LLEVLDGFER IHVVDFDIGY GRQWASLMQE LALRSGGAPT LKITALASPS  540
THDQLELGLT RESLIHFANE INMEFEFEIL SIDSLNSTSW SLPPLVSENE AIAVNLPISS  600
LASYQLSLPL VLRFVKQLSP RIVVSVDKGC DRTDLPFPNH VIQILQSYSN LLESLDAVNV  660
NFDALQKIER FLLQPRIERI VMSRYRSPEK TQHWRALFLS SGLSPLPLSN FTESQAVCVV  720
KRTPVRGFHV EKRQSSLVLW WQRKELISAS AWRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-343917534375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009762628.10.0PREDICTED: scarecrow-like protein 22
TrEMBLA0A1U7V8B40.0A0A1U7V8B4_NICSY; scarecrow-like protein 22
STRINGXP_009762628.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62532235
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-132GRAS family protein