PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf03500g02001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 282aa    MW: 32320.9 Da    PI: 8.8094
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf03500g02001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.91.2e-082569345
                              SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
           Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                               WT+eE +++  a + +      +W ++a  ++ g+t +++   + 
  Niben101Scf03500g02001.1 25 EWTQEENKKFESALAIYDETtpnRWFKVADLIP-GKTVYDVMKQYK 69
                              7*****************99*************.*******98876 PP

2Myb_DNA-binding40.65.8e-13133177347
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               +WT+eE+ +++ +  ++G+g+W+ I+r +   +t+ q+ s+ qky
  Niben101Scf03500g02001.1 133 PWTEEEHRRFLMGLDKHGKGDWRNISRNFVISKTPTQVASHAQKY 177
                               8*****************************789***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-41770IPR009057Homeodomain-like
PROSITE profilePS512937.9252176IPR017884SANT domain
SMARTSM007173.2E-92274IPR001005SANT/Myb domain
SuperFamilySSF466891.94E-112476IPR009057Homeodomain-like
PfamPF002491.6E-62569IPR001005SANT/Myb domain
CDDcd001675.81E-82571No hitNo description
Gene3DG3DSA:1.10.10.603.5E-11123180IPR009057Homeodomain-like
PROSITE profilePS5129419.38126182IPR017930Myb domain
SuperFamilySSF466893.37E-16127181IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-17129181IPR006447Myb domain, plants
SMARTSM007178.4E-11130180IPR001005SANT/Myb domain
PfamPF002494.0E-11133177IPR001005SANT/Myb domain
CDDcd001676.21E-9133177No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
METLSPTSLI PNSSWMMMEQ RKSSEWTQEE NKKFESALAI YDETTPNRWF KVADLIPGKT  60
VYDVMKQYKE LAADVSDIEA GLFPVPPTYF ASSFMLDLVD DHHFYHHHHH HRGVQSFKKR  120
GRCYDQERKK GVPWTEEEHR RFLMGLDKHG KGDWRNISRN FVISKTPTQV ASHAQKYYLR  180
QLSGGKDKRR PSIHDITTVN LTNIDFSNNN LNSNNNNNNN NKSLSSFVVN NPFQNSNDGG  240
AFMAFGSSYN SSSYPYELGS VLFRGRYGAD TIGASDSSQI WG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117129KKRGRCYDQERKK
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767350.11e-173PREDICTED: transcription factor DIVARICATA-like
RefseqXP_016475542.11e-173PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H72e-83DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A1S4AFU11e-172A0A1S4AFU1_TOBAC; transcription factor DIVARICATA-like
TrEMBLA0A1U7VZB71e-172A0A1U7VZB7_NICSY; transcription factor DIVARICATA-like
STRINGXP_009767350.11e-173(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.13e-81MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]