PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf03337g06007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 934aa    MW: 103421 Da    PI: 6.3559
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf03337g06007.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS324.12.9e-993907502373
                      GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfse 86 
                               +++L+++Ae v++g+  laq +Larl+++ sp g+p  R+a+y +eAL+  l+ ++++l +   ps++ + + + ++ a+k fse
  Niben101Scf03337g06007.1 390 IDQLFKAAELVQTGNPVLAQGILARLNHQLSPIGKPYYRAAFYCKEALELLLHTNTNNLNNPSIPSSS-PFSLIFKIGAYKSFSE 473
                               689***************************************************88888876655544.467************* PP

                      GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAee 171
                               +sP+ +f+++t+Nqa+le ++g er+Hi+Dfdi++G QW++L+q+La R++g+p+l+iT+++sp+++++ el  t+e L +fA+e
  Niben101Scf03337g06007.1 474 ISPVAQFANFTCNQAMLEVLDGFERIHIVDFDIGYGRQWASLMQELALRSGGAPTLKITALASPSTHDQLELGLTRESLIHFANE 558
                               ************************************************************************************* PP

                      GRAS 172 lgvpfefnvlvakrledleleeL..rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFl 254
                               ++++fef++l  ++l++   ++L   v+++Ea+aVnl ++ ++ +  ++sl+     vL++vk+lsP++vv v++ +d+++ +F 
  Niben101Scf03337g06007.1 559 INIEFEFEILSIDSLNST-SWSLppLVSENEAIAVNLPISSFSSY--QLSLPL----VLRFVKQLSPRIVVSVDKSCDRTDLPFP 636
                               *********977766665.4555334788**********999988..566655....**************************** PP

                      GRAS 255 erflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakl 339
                               +++++ l+ ys +++sl+a    + ++ +k+Er+ll+++i+ +++ +  +     e+ + Wr+ + ++G++p+p+s+++++qa++
  Niben101Scf03337g06007.1 637 NHVIQVLQSYSNILESLDAV-NVNFDTLQKIERFLLQPRIERILMGRFCS----PEKTQYWRALFLSSGLSPLPFSNFTESQAEC 716
                               *****************665.3466999****************987776....9****************************** PP

                      GRAS 340 llrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                               l ++++++g+++e+++ slvl+W++++L+s+SaW
  Niben101Scf03337g06007.1 717 LGKRTPVRGFHIEKRQSSLVLCWQRKELISASAW 750
                               ********************************** PP

2GRAS1281.1e-39766933196374
                      GRAS 196 vkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                               v+++Ea+aVnl ++ ++ +  ++sl+     vL++vk+lsP++vv v++ +d+++ +F +++++ l+ ys +++sl+a    + +
  Niben101Scf03337g06007.1 766 VSENEAIAVNLPISSFSSY--QLSLPL----VLRFVKQLSPRIVVSVDKSCDRTDLPFPNHVIQVLQSYSNILESLDAV-NVNFD 843
                               6789*********999988..566655....*********************************************665.34669 PP

                      GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdr 365
                               + +k+Er+ll+++i+ +++ +  +     e+ + Wr+ + ++G++p+p+s+++++qa++l ++++++g+++e+++ slvl+W+++
  Niben101Scf03337g06007.1 844 TLQKIERFLLQPRIERILMGRFCS----PEKTQYWRALFLSSGLSPLPFSNFTESQAECLGKRTPVRGFHIEKRQSSLVLCWQRK 924
                               99****************987776....9******************************************************** PP

                      GRAS 366 pLvsvSaWr 374
                               +L+s+SaWr
  Niben101Scf03337g06007.1 925 ELISASAWR 933
                               ********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.959363731IPR005202Transcription factor GRAS
PfamPF035149.9E-97390750IPR005202Transcription factor GRAS
PROSITE profilePS509859.491762913IPR005202Transcription factor GRAS
PfamPF035143.8E-37766933IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 934 aa     Download sequence    Send to blast
MKGMPLPFDF EGKGVLDLDV VLNKNSILNS WNNKNNNSKE SCYLVNSPSA VLDIIRSPRP  60
VNSSSTLSSS LGGGGGGGTA STDTACAVSA NPSSKWQQQQ QDNTTATSSN VGGAAAESEF  120
QQVAAATEGK KCGMEEWEGG LSESVMASPC QEQSILGWIM GDVDDPSMSN LNKVLQVSSP  180
MDYEFNAGFG VVDQGFGVDQ IGTSSFMPAI NSSSVSSFPP TTTRMKSDKI GLLSNIPTNL  240
PQNPIFPSFS NNLGPVSFSQ TQQQPFESTD LKPQSFHSQF LINQHQTQIP QNPSFLLPLP  300
FAQQEQNLVL PPKAKRHNPG TLEQQGSQIS QQLFIDAGQQ QPPPSHQLQL LPHFRPGGPI  360
GTKPKMVGEE MGQFHQLQLQ QQQQQQQAII DQLFKAAELV QTGNPVLAQG ILARLNHQLS  420
PIGKPYYRAA FYCKEALELL LHTNTNNLNN PSIPSSSPFS LIFKIGAYKS FSEISPVAQF  480
ANFTCNQAML EVLDGFERIH IVDFDIGYGR QWASLMQELA LRSGGAPTLK ITALASPSTH  540
DQLELGLTRE SLIHFANEIN IEFEFEILSI DSLNSTSWSL PPLVSENEAI AVNLPISSFS  600
SYQLSLPLVL RFVKQLSPRI VVSVDKSCDR TDLPFPNHVI QVLQSYSNIL ESLDAVNVNF  660
DTLQKIERFL LQPRIERILM GRFCSPEKTQ YWRALFLSSG LSPLPFSNFT ESQAECLGKR  720
TPVRGFHIEK RQSSLVLCWQ RKELISASAW SIDSLNSTSW SLPPLVSENE AIAVNLPISS  780
FSSYQLSLPL VLRFVKQLSP RIVVSVDKSC DRTDLPFPNH VIQVLQSYSN ILESLDAVNV  840
NFDTLQKIER FLLQPRIERI LMGRFCSPEK TQYWRALFLS SGLSPLPFSN FTESQAECLG  900
KRTPVRGFHI EKRQSSLVLC WQRKELISAS AWRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-3540475018374GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009762628.10.0PREDICTED: scarecrow-like protein 22
SwissprotO813161e-138SCL6_ARATH; Scarecrow-like protein 6
TrEMBLA0A1U7V8B40.0A0A1U7V8B4_NICSY; scarecrow-like protein 22
STRINGXP_009762628.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62532235
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-118GRAS family protein
Publications ? help Back to Top
  1. Bari A,Orazova S,Ivashchenko A
    miR156- and miR171-binding sites in the protein-coding sequences of several plant genes.
    Biomed Res Int, 2013. 2013: p. 307145
    [PMID:23936788]
  2. Xue XY, et al.
    Interaction between two timing microRNAs controls trichome distribution in Arabidopsis.
    PLoS Genet., 2014. 10(4): p. e1004266
    [PMID:24699192]