PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf03099g04004.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 121aa MW: 13548.8 Da PI: 10.6275 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 28 | 5.2e-09 | 26 | 70 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+ T+eE+ l + + +++G++ Wk+Ia +++ g t+k + +w + Niben101Scf03099g04004.1 26 KGSLTPEEQNLVIPLQAKYGNK-WKKIATEVP-GCTAKRLGKWWEVF 70 6788******************.*********.99999988888765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50090 | 4.101 | 1 | 20 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 1.0E-7 | 6 | 31 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 2.81E-15 | 6 | 78 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 19.356 | 21 | 75 | IPR017930 | Myb domain |
SMART | SM00717 | 3.7E-5 | 25 | 73 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.7E-7 | 26 | 67 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 6.84E-5 | 30 | 71 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.0E-9 | 32 | 75 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 121 aa Download sequence Send to blast |
MGKTLDRDPK ACFERWKNYL KPGIKKGSLT PEEQNLVIPL QAKYGNKWKK IATEVPGCTA 60 KRLGKWWEVF KEKQLKQLQK SRKLQDYADQ PSISTVSCGG SPEGAVSGKA KNSRARGLSL 120 L |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor required for normal cell differentiation. Interacts directly with asymmetric leaves 2 (AS2) to repress the knox homeobox genes. {ECO:0000269|PubMed:10102816, ECO:0000269|PubMed:12750468, ECO:0000269|PubMed:9655808}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009784773.1 | 2e-63 | PREDICTED: protein rough sheath 2 homolog | ||||
Refseq | XP_016442099.1 | 2e-63 | PREDICTED: protein rough sheath 2 homolog | ||||
Swissprot | Q9S7B2 | 1e-36 | RS2_MAIZE; Protein rough sheath 2 | ||||
TrEMBL | A0A1S3XQD9 | 4e-62 | A0A1S3XQD9_TOBAC; protein rough sheath 2 homolog | ||||
TrEMBL | A0A1U7X1R3 | 4e-62 | A0A1U7X1R3_NICSY; protein rough sheath 2 homolog | ||||
STRING | XP_009784773.1 | 7e-63 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2933 | 24 | 45 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37630.1 | 2e-36 | MYB family protein |