PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02612g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 566aa    MW: 61879 Da    PI: 4.8797
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02612g00003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS451.26.7e-1381855571374
                      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                               lv++L++cAeav++++l+ a+al+ ++  la ++  +m+++a+yf+eALa+r+++        + p+++ e++ +++l++   f+
  Niben101Scf02612g00003.1 185 LVHTLMACAEAVQQDNLNVADALVRHIGILAVSQSGAMRKVATYFAEALARRIYK--------IYPQDSIESSYTDVLQM--HFY 259
                               689****************************************************........44666654445555544..4** PP

                      GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAe 170
                               e++P+lkf+h+taNqaIlea+ ++++vH+iDf+++qG+QWpaL+qaLa Rp+gpp +R+Tg+g+p+++++++l+++g++La++Ae
  Niben101Scf02612g00003.1 260 ETCPYLKFAHFTANQAILEAFTNCNKVHVIDFSLKQGMQWPALIQALALRPGGPPAFRLTGIGPPQPDNTDALQQVGWKLAQLAE 344
                               ************************************************************************************* PP

                      GRAS 171 elgvpfefnvlvakrledleleeLrvkp...gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnses 252
                               ++gv+fef+ +v+++l+dl+ e L++++    E++aVn+v++lhrll++++++e+    vL+ +k+++Pk+v++veqea+hn++ 
  Niben101Scf02612g00003.1 345 TIGVEFEFRGFVTNSLADLDAEILDLRSiteTEVVAVNSVFELHRLLARPGAVEK----VLNSIKQMNPKIVTIVEQEANHNASV 425
                               ************************9888888************************....************************** PP

                      GRAS 253 Flerflealeyysalfdsleaklpres.........eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvp 328
                               +l+rf eal+yys++fdsle+++++ s         +++ ++++++lgr+i+nvvaceg +r+erhetl++Wr r+++aGF pv+
  Niben101Scf02612g00003.1 426 LLDRFNEALHYYSTMFDSLESSVSSSStgltqpivnNQDLVMSEVYLGRQICNVVACEGVDRVERHETLSQWRVRMNSAGFDPVH 510
                               **********************666666666666669************************************************ PP

                      GRAS 329 lsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                               l+++a kqa++ll+ ++ +dgyrvee++g+l+lgW++rpL+++SaW+
  Niben101Scf02612g00003.1 511 LGSNAFKQASMLLALFAgGDGYRVEENDGCLMLGWHTRPLIATSAWQ 557
                               **********************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120411.7E-343197IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011291.7E-3531104No hitNo description
PROSITE profilePS5098567.736159536IPR005202Transcription factor GRAS
PfamPF035142.3E-135185557IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 566 aa     Download sequence    Send to blast
MKRDRDREKS QDGSSSGKSK IFEEQPDAGM DELLAVLGYK VKSSDMAEVA QKLEQLEMAM  60
CTTLEGGISH LSTDTVHKNP SDLSGWVQSM LSELNNTSVP SNFDMIGSIG EKDLCVSPGG  120
GASSSSITIN EQNRIISDDD LRAIPGGAVF ATESNKRQRS CVPLTTDATT RPVVLVDSQE  180
TGVRLVHTLM ACAEAVQQDN LNVADALVRH IGILAVSQSG AMRKVATYFA EALARRIYKI  240
YPQDSIESSY TDVLQMHFYE TCPYLKFAHF TANQAILEAF TNCNKVHVID FSLKQGMQWP  300
ALIQALALRP GGPPAFRLTG IGPPQPDNTD ALQQVGWKLA QLAETIGVEF EFRGFVTNSL  360
ADLDAEILDL RSITETEVVA VNSVFELHRL LARPGAVEKV LNSIKQMNPK IVTIVEQEAN  420
HNASVLLDRF NEALHYYSTM FDSLESSVSS SSTGLTQPIV NNQDLVMSEV YLGRQICNVV  480
ACEGVDRVER HETLSQWRVR MNSAGFDPVH LGSNAFKQAS MLLALFAGGD GYRVEENDGC  540
LMLGWHTRPL IATSAWQLKA AGDAGL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A1e-6718055614378Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway (By similarity). Its degradation is not essential for germination. {ECO:0000250, ECO:0000269|PubMed:15347801}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009796771.10.0PREDICTED: DELLA protein GAI-like
SwissprotQ7Y1B60.0GAI_SOLLC; DELLA protein GAI
TrEMBLA0A161F7380.0A0A161F738_NICBE; GAI1
TrEMBLA0A1U7Y4880.0A0A1U7Y488_NICSY; DELLA protein GAI-like
STRINGXP_009796771.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21262462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein
Publications ? help Back to Top
  1. Nir I, et al.
    The Tomato DELLA Protein PROCERA Acts in Guard Cells to Promote Stomatal Closure.
    Plant Cell, 2017. 29(12): p. 3186-3197
    [PMID:29150547]