PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf02385g00007.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 151aa MW: 17706.5 Da PI: 10.2302 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 27.4 | 7.7e-09 | 46 | 81 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEde+l +v+ +G ++R++k+c++rw +yl Niben101Scf02385g00007.1 46 KGAWTKEEDEILMSYVQIHG------------LNRCGKSCRLRWINYL 81 79******************............479***********97 PP | |||||||
2 | Myb_DNA-binding | 45.9 | 1.3e-14 | 87 | 130 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg++++eEd l+++++ +G++ W++Ia ++ gR ++++k++w++ Niben101Scf02385g00007.1 87 RGNFSQEEDNLIINLHSSHGNK-WSKIAFELT-GRKDNEIKNYWNT 130 89********************.********9.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 9.412 | 41 | 81 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.8E-24 | 44 | 128 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.7E-6 | 45 | 83 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.7E-7 | 46 | 81 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.0E-16 | 47 | 88 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.03E-6 | 48 | 81 | No hit | No description |
PROSITE profile | PS51294 | 23.099 | 82 | 136 | IPR017930 | Myb domain |
SMART | SM00717 | 6.4E-13 | 86 | 134 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.4E-13 | 87 | 130 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.57E-9 | 89 | 132 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.4E-24 | 89 | 135 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 151 aa Download sequence Send to blast |
LYNKIIQLNN LKVIKFYISI FVNLLFPCCF PAHANNINNN IRSLNKGAWT KEEDEILMSY 60 VQIHGLNRCG KSCRLRWINY LRPDIKRGNF SQEEDNLIIN LHSSHGNKWS KIAFELTGRK 120 DNEIKNYWNT KLSRKPNLLG IDPKTHKPIP N |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-24 | 43 | 135 | 24 | 127 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269|PubMed:11080161}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269|PubMed:11080161}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009622647.1 | 2e-64 | PREDICTED: transcription repressor MYB6-like | ||||
Swissprot | Q9SZP1 | 4e-47 | MYB4_ARATH; Transcription repressor MYB4 | ||||
TrEMBL | A0A0R0KAN7 | 6e-49 | A0A0R0KAN7_SOYBN; Uncharacterized protein | ||||
STRING | XP_009622647.1 | 8e-64 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G38620.1 | 2e-49 | myb domain protein 4 |