PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf02066g03007.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 99aa MW: 11078.8 Da PI: 9.0573 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.8 | 5e-18 | 16 | 63 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEdellv++++ G g+W++ ++ g+ R++k+c++rw +yl Niben101Scf02066g03007.1 16 KGKWTAEEDELLVKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWTNYL 63 79******************************99************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.6E-23 | 7 | 66 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 22.608 | 11 | 67 | IPR017930 | Myb domain |
SMART | SM00717 | 4.3E-13 | 15 | 65 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.2E-16 | 16 | 63 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 6.74E-23 | 17 | 91 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.73E-10 | 18 | 63 | No hit | No description |
PROSITE profile | PS50090 | 3.95 | 64 | 88 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 1.6E-8 | 67 | 90 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 99 aa Download sequence Send to blast |
MEMARAPCCE KVGLKKGKWT AEEDELLVKY IQANGEGSWR SLPKNAGLLR CGKSCRLRWT 60 NYLRSDLKRG KFTADEDETI VKLHSSLGNS FILCVTGGL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 6e-14 | 14 | 91 | 25 | 101 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Flavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis. Activates the expression of CHS, CHI, F3H and FLS1. Controls flavonol biosynthesis primarily in cotyledons and leaves (PubMed:17419845, PubMed:20731781). Confers tolerance to UV-B (PubMed:19895401). {ECO:0000269|PubMed:17419845, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:20731781}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Triggered by HY5 in response to light and UV-B. {ECO:0000269|PubMed:19895401}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009801899.1 | 8e-53 | PREDICTED: myb-related protein 330-like | ||||
Refseq | XP_016444804.1 | 8e-53 | PREDICTED: myb-related protein 330-like | ||||
Swissprot | Q9FJ07 | 2e-47 | MY111_ARATH; Transcription factor MYB111 | ||||
TrEMBL | A0A1S3XY78 | 2e-51 | A0A1S3XY78_TOBAC; myb-related protein 330-like | ||||
TrEMBL | A0A1U7YRQ0 | 2e-51 | A0A1U7YRQ0_NICSY; myb-related protein 330-like | ||||
STRING | XP_009801899.1 | 3e-52 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G49330.1 | 9e-50 | myb domain protein 111 |