PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02048g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 544aa    MW: 60518.2 Da    PI: 6.4534
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02048g00001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS427.11.4e-1301745441374
                      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                               l++lL++cAeav++ d + a+ l++ l++++s +g+pmqRl ay++e+L+arl++s+s++yk+l+++e +   ss+ l+++++++
  Niben101Scf02048g00001.1 174 LKDLLIACAEAVAEADITSAEGLMNVLEQRVSVSGEPMQRLSAYMLEGLRARLLSSGSTIYKKLKCNEPT---SSDLLSYMQVLY 255
                               5789*****************************************************************9...9*********** PP

                      GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakf 168
                               +++P++kf+++ aN  I ea+ +e+r+HiiDf+i qG QW+ Ll+ La Rp+gpp +R+Tgv++++s   +   l+ +gerL+k+
  Niben101Scf02048g00001.1 256 HICPYYKFAYMSANVIIGEAMRNENRIHIIDFQIAQGSQWMFLLHNLARRPGGPPYVRVTGVDDSQSAhaRGGGLKLVGERLEKV 340
                               ****************************************************************9988889999*********** PP

                      GRAS 169 AeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesF 253
                               Ae++gvpfef+  +a +  ++ele+L+v++gEalaVn+ ++lh+++desvs+ ++rd++L+lvkslsPk+v++veqe+++n+++F
  Niben101Scf02048g00001.1 341 AESCGVPFEFHG-AALSGCKVELENLQVRHGEALAVNFPYMLHHMPDESVSTMNHRDRLLRLVKSLSPKIVTLVEQESNTNTAPF 424
                               ************.8999******************************************************************** PP

                      GRAS 254 lerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqak 338
                               l rf e+l+yy+a+f+s++a  +r++++ri+ E+++++r++vn++acega+r+erhe ++kWr+rl +aGF p pls ++ + +k
  Niben101Scf02048g00001.1 425 LPRFRETLDYYTAMFESTDAARARDDKQRISAEEHCIARDVVNIIACEGADRVERHEPFGKWRARLVMAGFAPCPLSPSVGEAIK 509
                               ********************99*************************************************************** PP

                      GRAS 339 lllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                +l+ ++ + y++ e++++l+lgWk+r+L + SaWr
  Niben101Scf02048g00001.1 510 DMLKGYSPN-YKLSESQEALYLGWKNRALATSSAWR 544
                               *******55.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.268148525IPR005202Transcription factor GRAS
PfamPF035145.0E-128174544IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
Sequence ? help Back to Top
Protein Sequence    Length: 544 aa     Download sequence    Send to blast
MQASQGPRRS GDVQRLYYQP MQQVQQYYTP YQAVDNNIYN DSSSSETQFS FQTQNEQVFT  60
LDSLPATVHA IYDAAPSVSI SSNRSPFSPQ CSQSYISDPH HSFDNTCGSP VSGCSGVDDG  120
NGTKHVLREL KNKLLGPESD IDDCSSCSFN GVISKPSSFI KWNQVLDIAS RSDLKDLLIA  180
CAEAVAEADI TSAEGLMNVL EQRVSVSGEP MQRLSAYMLE GLRARLLSSG STIYKKLKCN  240
EPTSSDLLSY MQVLYHICPY YKFAYMSANV IIGEAMRNEN RIHIIDFQIA QGSQWMFLLH  300
NLARRPGGPP YVRVTGVDDS QSAHARGGGL KLVGERLEKV AESCGVPFEF HGAALSGCKV  360
ELENLQVRHG EALAVNFPYM LHHMPDESVS TMNHRDRLLR LVKSLSPKIV TLVEQESNTN  420
TAPFLPRFRE TLDYYTAMFE STDAARARDD KQRISAEEHC IARDVVNIIA CEGADRVERH  480
EPFGKWRARL VMAGFAPCPL SPSVGEAIKD MLKGYSPNYK LSESQEALYL GWKNRALATS  540
SAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-6018154326378Protein SCARECROW
5b3h_A2e-6018154325377Protein SCARECROW
5b3h_D2e-6018154325377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a positive regulator of continuous red light signals downstream of phytochrome B (phyB). Required for the regulation of hypocotyl elongation during de-etiolation. May be required to modulate phytochrome A (phyA) signal transduction in a phyB-independent way. {ECO:0000269|PubMed:16680434}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By osmotic and cold stresses, and UV-A/B. {ECO:0000269|PubMed:16680434}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019265171.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLA0A1J6IKM50.0A0A1J6IKM5_NICAT; Scarecrow-like protein 13
STRINGXP_009792736.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13