PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf02042g02002.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 161aa MW: 18066.3 Da PI: 7.1353 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 171.8 | 7.5e-54 | 24 | 119 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86 +eqdr+lPianv+rimk++lP+nakisk++ket+qecvsefisfvt+easdkc++ekrkt+ngdd++wal++lGf++y+epl+ y Niben101Scf02042g02002.1 24 KEQDRLLPIANVGRIMKQILPQNAKISKETKETMQECVSEFISFVTGEASDKCNKEKRKTVNGDDICWALGSLGFDNYAEPLNRY 108 89*********************************************************************************** PP NF-YB 87 lkkyrelegek 97 l++yre egek Niben101Scf02042g02002.1 109 LHRYRESEGEK 119 ********997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 6.3E-54 | 19 | 142 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.02E-40 | 26 | 143 | IPR009072 | Histone-fold |
Pfam | PF00808 | 6.1E-27 | 29 | 93 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 4.0E-18 | 57 | 75 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 60 | 76 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 4.0E-18 | 76 | 94 | No hit | No description |
PRINTS | PR00615 | 4.0E-18 | 95 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 161 aa Download sequence Send to blast |
MVDNINILGP IPKYNSISEE GGIKEQDRLL PIANVGRIMK QILPQNAKIS KETKETMQEC 60 VSEFISFVTG EASDKCNKEK RKTVNGDDIC WALGSLGFDN YAEPLNRYLH RYRESEGEKA 120 NQNKAATGNN NTEEGEKVEP QRKSAVLPTQ CRNLQGKFYG P |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 9e-45 | 23 | 114 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 9e-45 | 23 | 114 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019264713.1 | 1e-110 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
Swissprot | O82248 | 4e-57 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A314L547 | 1e-109 | A0A314L547_NICAT; Nuclear transcription factor y subunit b-5 | ||||
STRING | XP_009775948.1 | 1e-107 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 1e-59 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|