PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01943g11007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 488aa    MW: 54435.1 Da    PI: 6.8677
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01943g11007.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS440.11.6e-1341184881374
                      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                               l+++L++cA+a s+gdl  aq+l+++l++++s +g+p+qRl ay++e+L arl  s+s++yk+l+++e +   s e l+++++++
  Niben101Scf01943g11007.1 118 LKHVLIACAKAESNGDLLTAQWLISELRQMVSVSGEPIQRLGAYILEGLVARLGASGSSIYKSLRCKEPA---SFELLSYVHILH 199
                               689******************************************************************9...99********** PP

                      GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakf 168
                               ev+P++kf+++ aN aI ea++ e+rvHiiDf+isqG QW++L+qa+a+Rp+gpp++ iTg+++++s   +   l+ +ge+L+k+
  Niben101Scf01943g11007.1 200 EVCPYFKFGYMSANGAIAEAMKDEQRVHIIDFQISQGSQWVTLIQAFAARPGGPPHICITGIDDSKSAyaRGGGLNIVGEKLSKL 284
                               ****************************************************************888899999************ PP

                      GRAS 169 AeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesF 253
                               A++++vpfef++ +a +++d++le+L ++pgEalaVn+++ lh+++desvs+e++rd++++lvksl+Pkvv++ve e+++n++ F
  Niben101Scf01943g11007.1 285 AQSFKVPFEFHA-AAISTSDIQLENLGIRPGEALAVNFAFVLHHMPDESVSTENHRDRLIRLVKSLNPKVVTLVELESNTNTAAF 368
                               ************.8999******************************************************************** PP

                      GRAS 254 lerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqak 338
                               + rfle+l+yy+a+f+s++a+l+r+++eri+vE+++l+++ivn++aceg er+erhe l+kW++r+++aGF+p+pls+ +++++k
  Niben101Scf01943g11007.1 369 FPRFLETLDYYTAMFESIDATLSRAHKERINVEQHCLAKDIVNIIACEGIERVERHELLGKWKSRFRMAGFNPYPLSSLVNSTIK 453
                               ************************************************************************************* PP

                      GRAS 339 lllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                               +l+ ++ +  yr+ee++g+l+lgW++r+Lv+ +aW+
  Niben101Scf01943g11007.1 454 ALVGNYCD-KYRLEERDGALYLGWMSRNLVASCAWK 488
                               ******95.5*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.80392469IPR005202Transcription factor GRAS
PfamPF035145.6E-132118488IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0005737Cellular Componentcytoplasm
GO:0004871Molecular Functionsignal transducer activity
Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
MQASQRLRRS GMSDILYQSV QNTEASYLPQ FQTLDKQMTS INRTQGGNHS IQTYSDRYCT  60
MESSSPTGGH KLKELETVML GPNSDVLDSC DNSLLSCMSS PEIDSWRQMM EAIPRGDLKH  120
VLIACAKAES NGDLLTAQWL ISELRQMVSV SGEPIQRLGA YILEGLVARL GASGSSIYKS  180
LRCKEPASFE LLSYVHILHE VCPYFKFGYM SANGAIAEAM KDEQRVHIID FQISQGSQWV  240
TLIQAFAARP GGPPHICITG IDDSKSAYAR GGGLNIVGEK LSKLAQSFKV PFEFHAAAIS  300
TSDIQLENLG IRPGEALAVN FAFVLHHMPD ESVSTENHRD RLIRLVKSLN PKVVTLVELE  360
SNTNTAAFFP RFLETLDYYT AMFESIDATL SRAHKERINV EQHCLAKDIV NIIACEGIER  420
VERHELLGKW KSRFRMAGFN PYPLSSLVNS TIKALVGNYC DKYRLEERDG ALYLGWMSRN  480
LVASCAWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A5e-5912548726378Protein SCARECROW
5b3h_A4e-5912548725377Protein SCARECROW
5b3h_D4e-5912548725377Protein SCARECROW
5hyz_A5e-591224888375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019253281.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_019253282.10.0PREDICTED: scarecrow-like transcription factor PAT1
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A1J6I0730.0A0A1J6I073_NICAT; Scarecrow-like transcription factor pat1
STRINGXP_009761823.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Heyman J, et al.
    The heterodimeric transcription factor complex ERF115-PAT1 grants regeneration competence.
    Nat Plants, 2016. 2(11): p. 16165
    [PMID:27797356]