PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01834g04018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 174aa    MW: 20288.8 Da    PI: 6.6387
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01834g04018.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.61e-11246244
                              SSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
           Myb_DNA-binding  2 grWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                               +WT eEd+l+ +a  +++ +   +W +Ia +++ g+t ++++ ++
  Niben101Scf01834g04018.1  2 SKWTREEDKLFEHALVLYPEDianRWQLIADHVP-GKTTEDIIAHY 46
                              58********************************.**********9 PP

2Myb_DNA-binding47.15.6e-1587131347
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               +WT+eE+ l++ + +++G+g+W++I+r +  +Rt+ q+ s+ qky
  Niben101Scf01834g04018.1  87 PWTEEEHRLFLIGLEKYGKGDWRSISRNVVVTRTPTQVASHAQKY 131
                               8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007173.1E-7152IPR001005SANT/Myb domain
PROSITE profilePS5129412.659154IPR017930Myb domain
SuperFamilySSF466891.59E-12257IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-6349IPR009057Homeodomain-like
CDDcd001678.52E-10346No hitNo description
PfamPF002491.3E-10347IPR001005SANT/Myb domain
PROSITE profilePS5129422.67380136IPR017930Myb domain
SuperFamilySSF466891.52E-1782136IPR009057Homeodomain-like
TIGRFAMsTIGR015578.5E-1883135IPR006447Myb domain, plants
SMARTSM007174.4E-1284134IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-1284130IPR009057Homeodomain-like
CDDcd001675.10E-1087132No hitNo description
PfamPF002496.5E-1387131IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MSKWTREEDK LFEHALVLYP EDIANRWQLI ADHVPGKTTE DIIAHYDDLV HDLLEIDSGR  60
IELPTYTDDP VESNKKNTEI ERKKGTPWTE EEHRLFLIGL EKYGKGDWRS ISRNVVVTRT  120
PTQVASHAQK YFIRQQAMKK ERKRSSIHDI TTAVDTNPVP PQSSFQNQRG NFTM
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009795456.11e-127PREDICTED: transcription factor DIVARICATA-like
RefseqXP_016473251.11e-127PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H72e-55DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A1S4A9J21e-125A0A1S4A9J2_TOBAC; transcription factor DIVARICATA-like
TrEMBLA0A1U7Y0L81e-125A0A1U7Y0L8_NICSY; transcription factor DIVARICATA-like
STRINGXP_009795456.11e-126(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45472241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.14e-70MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]