PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01234g01012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 542aa    MW: 60738.6 Da    PI: 6.0321
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01234g01012.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4225e-1291735422374
                      GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfse 86 
                               +elL +cAeavs+ d + a+ l++ l++++s +g+pm+Rl ay++e+L+arl++s+s +yk+l+++e +   sse l+++++ ++
  Niben101Scf01234g01012.1 173 KELLDACAEAVSDADVSTAEVLMNILEQRVSVSGEPMERLSAYVLEGLRARLLSSGSIIYKKLKCKEPT---SSELLSYMQVIYN 254
                               78999***************************************************************9...9************ PP

                      GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfA 169
                               ++P++kf+++ aN  I ea+ +e+r+HiiDf+i qG QW+ Ll+ La Rp+gpp lRiTgv++++s   +   l+ +gerLa++A
  Niben101Scf01234g01012.1 255 MCPYYKFAYMSANVVIREAMTNENRIHIIDFQIAQGSQWMFLLHDLARRPGGPPFLRITGVDDSQSAhaRGGGLQLVGERLAEVA 339
                               ***************************************************************9988889999************ PP

                      GRAS 170 eelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFl 254
                               +++gvpfef+  +a +  +++le+L+v++gEalaVn+ ++lh+++desvs+ ++rd++L+lvk+lsPk+v++veqe+++n+++Fl
  Niben101Scf01234g01012.1 340 KSCGVPFEFHG-AALSGCEVQLENLHVRHGEALAVNFPYMLHHMPDESVSMINHRDRLLRLVKNLSPKIVTLVEQESNTNTAPFL 423
                               ***********.8999********************************************************************* PP

                      GRAS 255 erflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakl 339
                                rf e+l+yy+a+f+s++a  pr++++ri+ E+++++r+ivn++aceg +r+erhe ++kWr rl++aGF+p pls ++ ++++ 
  Niben101Scf01234g01012.1 424 PRFRETLDYYTAMFESINAARPRDDKQRISAEEHCVARDIVNIIACEGVDRVERHELFGKWRLRLMMAGFTPCPLSPSVGETIND 508
                               *****************9999**************************************************************** PP

                      GRAS 340 llrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                               +l++++ + yr  e++g+l+lgWk+r+L + SaWr
  Niben101Scf01234g01012.1 509 VLKEYSPN-YRFAESEGALYLGWKNRALATSSAWR 542
                               ******55.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.935146523IPR005202Transcription factor GRAS
PfamPF035141.7E-126173542IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MQASQRPQMS GGVHGLYNQP MQQVEQYYAP YHFKNNNCNN TSSVTQFAFQ TQNEHFFTLD  60
SLPATDYVVY DSPPALSVSS NRSPFSPQCS HSYMSDLHHS SDNNTCGSPF SGCSGVDDGD  120
LKHVLRELEN KLLGPESDTD DSCSCSFNDV VSKPSSLTRW NRVLDMAPSL NLKELLDACA  180
EAVSDADVST AEVLMNILEQ RVSVSGEPME RLSAYVLEGL RARLLSSGSI IYKKLKCKEP  240
TSSELLSYMQ VIYNMCPYYK FAYMSANVVI REAMTNENRI HIIDFQIAQG SQWMFLLHDL  300
ARRPGGPPFL RITGVDDSQS AHARGGGLQL VGERLAEVAK SCGVPFEFHG AALSGCEVQL  360
ENLHVRHGEA LAVNFPYMLH HMPDESVSMI NHRDRLLRLV KNLSPKIVTL VEQESNTNTA  420
PFLPRFRETL DYYTAMFESI NAARPRDDKQ RISAEEHCVA RDIVNIIACE GVDRVERHEL  480
FGKWRLRLMM AGFTPCPLSP SVGETINDVL KEYSPNYRFA ESEGALYLGW KNRALATSSA  540
WR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A6e-6117954125377Protein SCARECROW
5b3h_D6e-6117954125377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a positive regulator of continuous red light signals downstream of phytochrome B (phyB). Required for the regulation of hypocotyl elongation during de-etiolation. May be required to modulate phytochrome A (phyA) signal transduction in a phyB-independent way. {ECO:0000269|PubMed:16680434}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By osmotic and cold stresses, and UV-A/B. {ECO:0000269|PubMed:16680434}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016487801.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLA0A1S4BG190.0A0A1S4BG19_TOBAC; scarecrow-like protein 13
STRINGXP_009773976.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13