PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf01063g02004.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 67aa MW: 7864.96 Da PI: 11.0857 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.8 | 1e-17 | 6 | 49 | 1 | 44 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 +g+WT+eEd++lvd++++ G g+W++ +++ g++R +k+c++rw Niben101Scf01063g02004.1 6 KGPWTPEEDQKLVDYIHRNGHGNWRALPKRAGLNRYGKSCRLRW 49 79****************************************** PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 21.622 | 1 | 57 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 9.18E-18 | 3 | 67 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.3E-19 | 4 | 48 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.7E-10 | 5 | 55 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.3E-16 | 6 | 49 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.48E-9 | 8 | 49 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.8E-7 | 49 | 67 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 67 aa Download sequence Send to blast |
MNGLKKGPWT PEEDQKLVDY IHRNGHGNWR ALPKRAGLNR YGKSCRLRWS AIATRLRGRT 60 DNEIKNY |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269|PubMed:24902892}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269|PubMed:24902892}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019259157.1 | 4e-32 | PREDICTED: transcription factor MYB39-like | ||||
Swissprot | Q9S9Z2 | 7e-30 | MYB93_ARATH; Transcription factor MYB93 | ||||
TrEMBL | A0A314LEP5 | 1e-30 | A0A314LEP5_NICAT; Transcription factor myb39 | ||||
STRING | XP_009776410.1 | 8e-31 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA21622 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G34670.1 | 3e-32 | myb domain protein 93 |
Publications ? help Back to Top | |||
---|---|---|---|
|