PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf00650g06001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 147aa MW: 16808.2 Da PI: 9.8342 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 28.8 | 2.1e-09 | 100 | 133 | 22 | 55 |
SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 +yp++ ++ LA+++gL+ +q+ +WF N+R ++ Niben101Scf00650g06001.1 100 WPYPTEGDKNSLAESTGLDPKQINNWFINQRKRH 133 58*****************************985 PP | |||||||
2 | ELK | 32.7 | 1.6e-11 | 53 | 74 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK++LlrK++++L+sLk EFs Niben101Scf00650g06001.1 53 ELKDRLLRKFGSHLSSLKLEFS 74 9********************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03789 | 4.4E-8 | 53 | 74 | IPR005539 | ELK domain |
PROSITE profile | PS51213 | 10.196 | 53 | 73 | IPR005539 | ELK domain |
SMART | SM01188 | 8.4E-6 | 53 | 74 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.617 | 73 | 136 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 7.7E-20 | 74 | 143 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 1.0E-12 | 75 | 140 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 9.9E-29 | 78 | 137 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 2.63E-11 | 85 | 137 | No hit | No description |
Pfam | PF05920 | 5.1E-18 | 93 | 132 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 111 | 134 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 147 aa Download sequence Send to blast |
MTLGVCRILR KGCILADPAG AVTILRSPND GGVSSDEELS CGEAEGQRNE DNELKDRLLR 60 KFGSHLSSLK LEFSKKKKKG KLPKQARQML LAWWNDHYRW PYPTEGDKNS LAESTGLDPK 120 QINNWFINQR KRHWKPSENM QLAVMDN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016490194.1 | 2e-73 | PREDICTED: homeobox protein knotted-1-like 6 | ||||
Swissprot | Q84JS6 | 1e-53 | KNAT6_ARATH; Homeobox protein knotted-1-like 6 | ||||
TrEMBL | A0A1S4BMV4 | 4e-72 | A0A1S4BMV4_TOBAC; homeobox protein knotted-1-like 6 | ||||
STRING | XP_009759718.1 | 2e-70 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA753 | 24 | 80 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G23380.1 | 2e-45 | KNOTTED1-like homeobox gene 6 |
Publications ? help Back to Top | |||
---|---|---|---|
|