PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Niben101Scf00629g02006.1

Organism

Nicotiana benthamiana

Taxonomic ID

4100

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

MYB_related

Protein Properties

Length: 117aa MW: 13377.1 Da PI: 10.5287

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Niben101Scf00629g02006.1	genome	BTI	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	49.3	1.2e-15	33	80	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W++eEde+l ++ G g+W+ +ar g+ R++k+c++rw +yl Niben101Scf00629g02006.1 33 KGLWSPEEDEKLMHYMLTNGQGCWSDVARNAGLQRCGKSCRLRWINYL 80 678*******************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	2.7E-23	27	83	IPR009057	Homeodomain-like
PROSITE profile	PS51294	22.02	28	84	IPR017930	Myb domain
SMART	SM00717	1.4E-10	32	82	IPR001005	SANT/Myb domain
Pfam	PF00249	2.4E-14	33	80	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	2.82E-21	35	108	IPR009057	Homeodomain-like
CDD	cd00167	2.33E-8	36	80	No hit	No description
PROSITE profile	PS50090	4.24	81	117	IPR017877	Myb-like domain
Gene3D	G3DSA:1.10.10.60	1.1E-8	84	107	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 117 aa Download sequence Send to blast
MRKPEFSSSS SGKNGNGNNN NNNNNNANLK LRKGLWSPEE DEKLMHYMLT NGQGCWSDVA 60 RNAGLQRCGK SCRLRWINYL RPDLKRGAFS PQEEQLIIHL HSLLGNRKKT LNTIKDH

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	2e-14	28	107	22	100	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as molecular switch in the NAC012/SND1-mediated transcriptional network regulating secondary wall biosynthesis. Is directly activated by NAC012/SND1 and its close homologs, including NAC043/NST1, NAC066/NST2, NAC101/VND6 and NAC030/VND7. Is required for functional expression of a number of secondary wall-associated transcription factors and secondary wall biosynthetic genes involved in cellulose, xylan and lignin synthesis. Functions redundantly with MYB46 in the transcriptional regulatory cascade leading to secondary wall formation in fibers and vessels (PubMed:19808805). Transcription activator that binds to the DNA consensus sequence 5'-ACC[AT]A[AC][TC]-3', designated as the secondary wall MYB-responsive element (SMRE). Regulates directly numerous transcription factors and a number of genes involved in secondary wall biosynthesis that contain SMRE elements in their promoters (PubMed:22197883). {ECO:0000269\|PubMed:19808805, ECO:0000269\|PubMed:22197883}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009609673.1	5e-57	PREDICTED: transcription factor MYB46-like
Refseq	XP_016461843.1	7e-57	PREDICTED: transcription factor MYB46-like
Swissprot	Q9C6U1	3e-48	MYB83_ARATH; Transcription factor MYB83
TrEMBL	A0A1S3ZBR8	2e-55	A0A1S3ZBR8_TOBAC; transcription factor MYB46-like
STRING	XP_009609673.1	2e-56	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12	24	2154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G12870.1	2e-48	myb domain protein 46

Publications ? help Back to Top
Vargas L, et al. Improving total saccharification yield of Arabidopsis plants by vessel-specific complementation of caffeoyl shikimate esterase (cse) mutants. Biotechnol Biofuels, 2016. 9: p. 139 [PMID:27390589] Piya S,Kihm C,Rice JH,Baum TJ,Hewezi T Cooperative Regulatory Functions of miR858 and MYB83 during Cyst Nematode Parasitism. Plant Physiol., 2017. 174(3): p. 1897-1912 [PMID:28512179]