PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00468g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 356aa    MW: 40943.8 Da    PI: 8.1981
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00468g00006.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.5e-17146192148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
           Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                               +g WT eEd ll+++v+++G + W+ Ia+t+  gR +kqc++rw+++l
  Niben101Scf00468g00006.1 146 KGQWTIEEDRLLIQLVEKFGVRKWSQIAQTLK-GRIGKQCRERWHNHL 192
                               799****************************9.*************97 PP

2Myb_DNA-binding55.99.6e-18200240345
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
           Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                WT+eEd +l+ a+++ G++ W+ Ia++++ gRt++++k++w+
  Niben101Scf00468g00006.1 200 LWTEEEDRILISAHAEVGNK-WSEIAKRIP-GRTENSIKNHWN 240
                               6*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.202141196IPR017930Myb domain
SMARTSM007172.1E-14145194IPR001005SANT/Myb domain
SuperFamilySSF466891.12E-31146239IPR009057Homeodomain-like
PfamPF002491.5E-15146192IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-25147196IPR009057Homeodomain-like
CDDcd001673.68E-13149192No hitNo description
SMARTSM007174.4E-17197245IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-23197246IPR009057Homeodomain-like
PROSITE profilePS5129421.84197247IPR017930Myb domain
PfamPF002492.0E-16200240IPR001005SANT/Myb domain
CDDcd001673.40E-13201243No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MNDVFCTLSK DYLQDFHHLD LSFSIPTFNN PDHEIMIETN GYDPLFGPFS NIKDNYSSMD  60
QDFNFNYEFK PFDQNGASGS TLVNFSAVPD ESSCITTGDN NGNYGKKEIG GRKNKKLITK  120
SNENSLSSSS MRKQGRGRKK YSKSAKGQWT IEEDRLLIQL VEKFGVRKWS QIAQTLKGRI  180
GKQCRERWHN HLRPDIKKDL WTEEEDRILI SAHAEVGNKW SEIAKRIPGR TENSIKNHWN  240
ATKRRQFSRR KCRTKWPRPS SLLQNYIKSL NFEKGSSSIS NGTTLNNNAP KSEPFELCDK  300
GNIQQLVTDY DFSQVPEFGL DDKLFDDLEI PYNELPQLMQ AGEVNKEAEL MDLISS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-441462474105MYB PROTO-ONCOGENE PROTEIN
1h88_C8e-4414624758159MYB PROTO-ONCOGENE PROTEIN
1h89_C8e-4414624758159MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-441462464104C-Myb DNA-Binding Domain
1msf_C1e-441462464104C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the motif 5'-GTAACNT-3' in the promoter of target genes (e.g. DD11 and DD18) and promotes their expression within synergid cells (e.g. in the filiform apparatus) in ovules (PubMed:16214903, PubMed:17693534, PubMed:18410484, PubMed:17937500). Required for the formation of the filiform apparatus during synergid cell differentiation in the female gametophyte (PubMed:16214903). Involved in pollen tube guidance to the micropyle (PubMed:16214903, PubMed:17937500, PubMed:23093426). {ECO:0000269|PubMed:16214903, ECO:0000269|PubMed:17693534, ECO:0000269|PubMed:17937500, ECO:0000269|PubMed:18410484, ECO:0000269|PubMed:23093426}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016469577.10.0PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L29e-75MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A314L6K30.0A0A314L6K3_NICAT; Transcription factor myb98
STRINGXP_009595322.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31502349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.12e-76myb domain protein 98
Publications ? help Back to Top
  1. Mendes MA, et al.
    Live and let die: a REM complex promotes fertilization through synergid cell death in Arabidopsis.
    Development, 2016. 143(15): p. 2780-90
    [PMID:27338615]