PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Niben101Scf00428g05024.1

Organism

Nicotiana benthamiana

Taxonomic ID

4100

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

MYB

Protein Properties

Length: 152aa MW: 17998.8 Da PI: 10.6301

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Niben101Scf00428g05024.1	genome	BTI	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	26.5	1.5e-08	32	64	15	48
HHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 15 avkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 a+ +G + W+ Ia+++ R +kqc++rw+++l Niben101Scf00428g05024.1 32 AFDSFGVRKWSQIAQMLK-ERIGKQCRERWHNHL 64 666789999******9.***********97 PP
2	Myb_DNA-binding	53.9	4.1e-17	72	112	3	45
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 WT+eEd +l++a+++ G++ W+ Ia+++ gR+++++k++w+ Niben101Scf00428g05024.1 72 LWTEEEDRILIEAHAEVGNK-WAEIAKRLA-GRSENSIKNHWN 112 6*****************.*****.*********8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
CDD	cd00167	2.20E-5	31	64	No hit	No description
SMART	SM00717	4	31	66	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.5E-19	33	72	IPR009057	Homeodomain-like
PROSITE profile	PS50090	7.364	36	64	IPR017877	Myb-like domain
Pfam	PF13921	5.9E-9	39	70	No hit	No description
SuperFamily	SSF46689	1.49E-27	44	122	IPR009057	Homeodomain-like
PROSITE profile	PS51294	26.343	65	119	IPR017930	Myb domain
SMART	SM00717	9.8E-17	69	117	IPR001005	SANT/Myb domain
Pfam	PF00249	6.8E-16	72	112	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	6.4E-22	73	118	IPR009057	Homeodomain-like
CDD	cd00167	6.89E-12	73	115	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 152 aa Download sequence Send to blast
MEDIHVGTPP SIMEKCMGLE IILPTFMQGD QAFDSFGVRK WSQIAQMLKE RIGKQCRERW 60 HNHLRPDIKK DLWTEEEDRI LIEAHAEVGN KWAEIAKRLA GRSENSIKNH WNATKRRQFS 120 RRKCRNKWPK PTQLHQKLEF GKGKQQNKLL SN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	4e-36	36	119	22	105	MYB PROTO-ONCOGENE PROTEIN
1h88_C	2e-35	36	119	76	159	MYB PROTO-ONCOGENE PROTEIN
1h89_C	2e-35	36	119	76	159	MYB PROTO-ONCOGENE PROTEIN
1h8a_C	7e-36	36	119	45	128	MYB TRANSFORMING PROTEIN
1mse_C	3e-36	36	119	22	105	C-Myb DNA-Binding Domain
1msf_C	3e-36	36	119	22	105	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the motif 5'-GTAACNT-3' in the promoter of target genes (e.g. DD11 and DD18) and promotes their expression within synergid cells (e.g. in the filiform apparatus) in ovules (PubMed:16214903, PubMed:17693534, PubMed:18410484, PubMed:17937500). Required for the formation of the filiform apparatus during synergid cell differentiation in the female gametophyte (PubMed:16214903). Involved in pollen tube guidance to the micropyle (PubMed:16214903, PubMed:17937500, PubMed:23093426). {ECO:0000269\|PubMed:16214903, ECO:0000269\|PubMed:17693534, ECO:0000269\|PubMed:17937500, ECO:0000269\|PubMed:18410484, ECO:0000269\|PubMed:23093426}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009777823.1	7e-62	PREDICTED: transcription factor MYB98-like
Refseq	XP_016433498.1	7e-62	PREDICTED: transcription factor MYB98-like
Refseq	XP_016480674.1	8e-62	PREDICTED: transcription factor MYB98-like
Swissprot	Q9S7L2	1e-53	MYB98_ARATH; Transcription factor MYB98
TrEMBL	A0A1S3X1D3	2e-60	A0A1S3X1D3_TOBAC; transcription factor MYB98-like
TrEMBL	A0A1S3ZYR7	4e-60	A0A1S3ZYR7_TOBAC; transcription factor MYB98-like
TrEMBL	A0A1S4AVH3	2e-60	A0A1S4AVH3_TOBAC; transcription factor MYB98-like
TrEMBL	A0A1U7WGP3	2e-60	A0A1U7WGP3_NICSY; transcription factor MYB98-like
STRING	XP_009777823.1	3e-61	(Nicotiana sylvestris)
STRING	XP_009595322.1	5e-61	(Nicotiana tomentosiformis)
STRING	XP_009603629.1	1e-60	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA3150	23	49

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18770.1	5e-56	myb domain protein 98

Publications ? help Back to Top
Mendes MA, et al. Live and let die: a REM complex promotes fertilization through synergid cell death in Arabidopsis. Development, 2016. 143(15): p. 2780-90 [PMID:27338615]