PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00428g05024.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 152aa    MW: 17998.8 Da    PI: 10.6301
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00428g05024.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.51.5e-0832641548
                              HHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
           Myb_DNA-binding 15 avkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                              a+  +G + W+ Ia+++   R +kqc++rw+++l
  Niben101Scf00428g05024.1 32 AFDSFGVRKWSQIAQMLK-ERIGKQCRERWHNHL 64
                              666789999********9.*************97 PP

2Myb_DNA-binding53.94.1e-1772112345
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
           Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                WT+eEd +l++a+++ G++ W+ Ia+++  gR+++++k++w+
  Niben101Scf00428g05024.1  72 LWTEEEDRILIEAHAEVGNK-WAEIAKRLA-GRSENSIKNHWN 112
                               6*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001672.20E-53164No hitNo description
SMARTSM0071743166IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-193372IPR009057Homeodomain-like
PROSITE profilePS500907.3643664IPR017877Myb-like domain
PfamPF139215.9E-93970No hitNo description
SuperFamilySSF466891.49E-2744122IPR009057Homeodomain-like
PROSITE profilePS5129426.34365119IPR017930Myb domain
SMARTSM007179.8E-1769117IPR001005SANT/Myb domain
PfamPF002496.8E-1672112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-2273118IPR009057Homeodomain-like
CDDcd001676.89E-1273115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
MEDIHVGTPP SIMEKCMGLE IILPTFMQGD QAFDSFGVRK WSQIAQMLKE RIGKQCRERW  60
HNHLRPDIKK DLWTEEEDRI LIEAHAEVGN KWAEIAKRLA GRSENSIKNH WNATKRRQFS  120
RRKCRNKWPK PTQLHQKLEF GKGKQQNKLL SN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-363611922105MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-353611976159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-353611976159MYB PROTO-ONCOGENE PROTEIN
1h8a_C7e-363611945128MYB TRANSFORMING PROTEIN
1mse_C3e-363611922105C-Myb DNA-Binding Domain
1msf_C3e-363611922105C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the motif 5'-GTAACNT-3' in the promoter of target genes (e.g. DD11 and DD18) and promotes their expression within synergid cells (e.g. in the filiform apparatus) in ovules (PubMed:16214903, PubMed:17693534, PubMed:18410484, PubMed:17937500). Required for the formation of the filiform apparatus during synergid cell differentiation in the female gametophyte (PubMed:16214903). Involved in pollen tube guidance to the micropyle (PubMed:16214903, PubMed:17937500, PubMed:23093426). {ECO:0000269|PubMed:16214903, ECO:0000269|PubMed:17693534, ECO:0000269|PubMed:17937500, ECO:0000269|PubMed:18410484, ECO:0000269|PubMed:23093426}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009777823.17e-62PREDICTED: transcription factor MYB98-like
RefseqXP_016433498.17e-62PREDICTED: transcription factor MYB98-like
RefseqXP_016480674.18e-62PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L21e-53MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A1S3X1D32e-60A0A1S3X1D3_TOBAC; transcription factor MYB98-like
TrEMBLA0A1S3ZYR74e-60A0A1S3ZYR7_TOBAC; transcription factor MYB98-like
TrEMBLA0A1S4AVH32e-60A0A1S4AVH3_TOBAC; transcription factor MYB98-like
TrEMBLA0A1U7WGP32e-60A0A1U7WGP3_NICSY; transcription factor MYB98-like
STRINGXP_009777823.13e-61(Nicotiana sylvestris)
STRINGXP_009595322.15e-61(Nicotiana tomentosiformis)
STRINGXP_009603629.11e-60(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31502349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.15e-56myb domain protein 98
Publications ? help Back to Top
  1. Mendes MA, et al.
    Live and let die: a REM complex promotes fertilization through synergid cell death in Arabidopsis.
    Development, 2016. 143(15): p. 2780-90
    [PMID:27338615]