![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
Previous version:
v3.0
v4.0
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf00428g05024.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 152aa MW: 17998.8 Da PI: 10.6301 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 26.5 | 1.5e-08 | 32 | 64 | 15 | 48 |
HHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 15 avkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 a+ +G + W+ Ia+++ R +kqc++rw+++l Niben101Scf00428g05024.1 32 AFDSFGVRKWSQIAQMLK-ERIGKQCRERWHNHL 64 666789999********9.*************97 PP | |||||||
2 | Myb_DNA-binding | 53.9 | 4.1e-17 | 72 | 112 | 3 | 45 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 WT+eEd +l++a+++ G++ W+ Ia+++ gR+++++k++w+ Niben101Scf00428g05024.1 72 LWTEEEDRILIEAHAEVGNK-WAEIAKRLA-GRSENSIKNHWN 112 6*******************.*********.***********8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
CDD | cd00167 | 2.20E-5 | 31 | 64 | No hit | No description |
SMART | SM00717 | 4 | 31 | 66 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.5E-19 | 33 | 72 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50090 | 7.364 | 36 | 64 | IPR017877 | Myb-like domain |
Pfam | PF13921 | 5.9E-9 | 39 | 70 | No hit | No description |
SuperFamily | SSF46689 | 1.49E-27 | 44 | 122 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 26.343 | 65 | 119 | IPR017930 | Myb domain |
SMART | SM00717 | 9.8E-17 | 69 | 117 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.8E-16 | 72 | 112 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.4E-22 | 73 | 118 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.89E-12 | 73 | 115 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 152 aa Download sequence Send to blast |
MEDIHVGTPP SIMEKCMGLE IILPTFMQGD QAFDSFGVRK WSQIAQMLKE RIGKQCRERW 60 HNHLRPDIKK DLWTEEEDRI LIEAHAEVGN KWAEIAKRLA GRSENSIKNH WNATKRRQFS 120 RRKCRNKWPK PTQLHQKLEF GKGKQQNKLL SN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 4e-36 | 36 | 119 | 22 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1h88_C | 2e-35 | 36 | 119 | 76 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 2e-35 | 36 | 119 | 76 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h8a_C | 7e-36 | 36 | 119 | 45 | 128 | MYB TRANSFORMING PROTEIN |
1mse_C | 3e-36 | 36 | 119 | 22 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 3e-36 | 36 | 119 | 22 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the motif 5'-GTAACNT-3' in the promoter of target genes (e.g. DD11 and DD18) and promotes their expression within synergid cells (e.g. in the filiform apparatus) in ovules (PubMed:16214903, PubMed:17693534, PubMed:18410484, PubMed:17937500). Required for the formation of the filiform apparatus during synergid cell differentiation in the female gametophyte (PubMed:16214903). Involved in pollen tube guidance to the micropyle (PubMed:16214903, PubMed:17937500, PubMed:23093426). {ECO:0000269|PubMed:16214903, ECO:0000269|PubMed:17693534, ECO:0000269|PubMed:17937500, ECO:0000269|PubMed:18410484, ECO:0000269|PubMed:23093426}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009777823.1 | 7e-62 | PREDICTED: transcription factor MYB98-like | ||||
Refseq | XP_016433498.1 | 7e-62 | PREDICTED: transcription factor MYB98-like | ||||
Refseq | XP_016480674.1 | 8e-62 | PREDICTED: transcription factor MYB98-like | ||||
Swissprot | Q9S7L2 | 1e-53 | MYB98_ARATH; Transcription factor MYB98 | ||||
TrEMBL | A0A1S3X1D3 | 2e-60 | A0A1S3X1D3_TOBAC; transcription factor MYB98-like | ||||
TrEMBL | A0A1S3ZYR7 | 4e-60 | A0A1S3ZYR7_TOBAC; transcription factor MYB98-like | ||||
TrEMBL | A0A1S4AVH3 | 2e-60 | A0A1S4AVH3_TOBAC; transcription factor MYB98-like | ||||
TrEMBL | A0A1U7WGP3 | 2e-60 | A0A1U7WGP3_NICSY; transcription factor MYB98-like | ||||
STRING | XP_009777823.1 | 3e-61 | (Nicotiana sylvestris) | ||||
STRING | XP_009595322.1 | 5e-61 | (Nicotiana tomentosiformis) | ||||
STRING | XP_009603629.1 | 1e-60 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3150 | 23 | 49 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G18770.1 | 5e-56 | myb domain protein 98 |
Publications ? help Back to Top | |||
---|---|---|---|
|