PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00348g08003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 284aa    MW: 32330 Da    PI: 8.617
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00348g08003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.82.5e-082873346
                              SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
           Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                              +WT eE + + da +++ ++    W  +a++++ g+t ++++  ++ 
  Niben101Scf00348g08003.1 28 KWTVEENKMFEDALALFDKDtpdKWYNVAAMIP-GKTVNDVIKQYRE 73
                              8********************************.********99986 PP

2Myb_DNA-binding46.31e-14137181347
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               +WT+eE+ +++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
  Niben101Scf00348g08003.1 137 PWTEEEHRQFLLGLKKYGKGDWRNISRNFVTTRTPTQVASHAQKY 181
                               8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.4212479IPR017884SANT domain
SMARTSM007172.1E-92577IPR001005SANT/Myb domain
CDDcd001675.91E-72875No hitNo description
PfamPF002497.9E-72874IPR001005SANT/Myb domain
SuperFamilySSF466891.94E-112882IPR009057Homeodomain-like
PROSITE profilePS5129421.106130186IPR017930Myb domain
SuperFamilySSF466891.94E-17132185IPR009057Homeodomain-like
TIGRFAMsTIGR015578.1E-18133185IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.2E-12134181IPR009057Homeodomain-like
SMARTSM007173.5E-13134184IPR001005SANT/Myb domain
PfamPF002493.6E-12137181IPR001005SANT/Myb domain
CDDcd001677.35E-11137182No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MNREMGFLSP ATYIKNSSWL FEENKVTKWT VEENKMFEDA LALFDKDTPD KWYNVAAMIP  60
GKTVNDVIKQ YRELVEDITD IEAGLIPVPG NTTSNSFTLE WVNNQDGLHG FKKFYGQNGK  120
RGASNRSSEH ERKKGVPWTE EEHRQFLLGL KKYGKGDWRN ISRNFVTTRT PTQVASHAQK  180
YFIRQLSGGK DKRRSSIHDI TVVNLSESKS STSPDNHSQQ QHHSMVKTLC DYNSPNQESD  240
VTFNSSAGTL INTPFRGVSS YSLEHGMPNI TLQSLQFGNY NTMC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A7e-1629941176RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009786719.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_016468737.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H74e-97DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A1S3ZWH90.0A0A1S3ZWH9_TOBAC; transcription factor DIVARICATA-like
TrEMBLA0A1U7XID90.0A0A1U7XID9_NICSY; transcription factor DIVARICATA-like
STRINGXP_009786719.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-111MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]