PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf00347g00011.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 160aa MW: 18223.1 Da PI: 9.168 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 130.1 | 8.1e-41 | 42 | 118 | 1 | 77 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 +Cq+++C++dls+ak+yh+rhkvCe+h+ka++v+v+g +qrfCqqCsrfhe+ efDe+krsCrrrLa+hnerrrk++ Niben101Scf00347g00011.1 42 CCQADKCTVDLSDAKQYHKRHKVCEFHAKAQAVVVAGFRQRFCQQCSRFHEVGEFDESKRSCRRRLAGHNERRRKTS 118 6**************************************************************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 9.1E-32 | 36 | 104 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 31.573 | 40 | 117 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.31E-36 | 41 | 120 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.8E-31 | 43 | 116 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 160 aa Download sequence Send to blast |
MEAADNNDLF IFATDNDDKK KRNPSYNNNN EKIKGSSTTM RCCQADKCTV DLSDAKQYHK 60 RHKVCEFHAK AQAVVVAGFR QRFCQQCSRF HEVGEFDESK RSCRRRLAGH NERRRKTSSS 120 SDQCNSEGSS SRKAIIGSDT HQTINFQENA TAGYKQFQLG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 3e-37 | 37 | 116 | 5 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00359 | DAP | Transfer from AT3G15270 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156. {ECO:0000269|PubMed:16914499}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019251876.1 | 2e-93 | PREDICTED: squamosa promoter-binding-like protein 3 | ||||
Swissprot | Q9S758 | 7e-42 | SPL5_ARATH; Squamosa promoter-binding-like protein 5 | ||||
TrEMBL | A0A1S3ZR67 | 6e-92 | A0A1S3ZR67_TOBAC; squamosa promoter-binding-like protein 3 | ||||
STRING | XP_009620386.1 | 2e-92 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA749 | 24 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G15270.1 | 3e-44 | squamosa promoter binding protein-like 5 |
Publications ? help Back to Top | |||
---|---|---|---|
|