PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Ctg03201g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 107aa MW: 12718.5 Da PI: 8.3286 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 87 | 3.1e-27 | 2 | 104 | 271 | 373 |
GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveees 355 ++a+lpr++++r E+e+ +re++nv+aceg+er+er et+++W+ r ++aGFk +pl+++ +++ ++ ++ + + + +e+ Niben101Ctg03201g00001.1 2 FDATLPRDDQQRLHFEQEFYRREAMNVIACEGSERVERPETYKQWQVRNMRAGFKLLPLNQQLMQKLSCKVKGGYHRDFVFDEDG 86 5899**********************************************************************9999******* PP GRAS 356 gslvlgWkdrpLvsvSaW 373 +++++gWk+r L S+W Niben101Ctg03201g00001.1 87 NWMLQGWKGRVLCGSSCW 104 ****************** PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 16.453 | 1 | 85 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 1.1E-24 | 2 | 104 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 107 aa Download sequence Send to blast |
MFDATLPRDD QQRLHFEQEF YRREAMNVIA CEGSERVERP ETYKQWQVRN MRAGFKLLPL 60 NQQLMQKLSC KVKGGYHRDF VFDEDGNWML QGWKGRVLCG SSCWVPA |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. | |||||
UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009606498.1 | 2e-71 | PREDICTED: scarecrow-like protein 14 | ||||
Refseq | XP_016485888.1 | 2e-71 | PREDICTED: scarecrow-like protein 14 | ||||
Refseq | XP_016488598.1 | 4e-73 | PREDICTED: scarecrow-like protein 14, partial | ||||
Swissprot | Q3EDH0 | 7e-44 | SCL31_ARATH; Scarecrow-like protein 31 | ||||
Swissprot | Q9XE58 | 8e-44 | SCL14_ARATH; Scarecrow-like protein 14 | ||||
TrEMBL | A0A1S4BAP2 | 5e-70 | A0A1S4BAP2_TOBAC; scarecrow-like protein 14 | ||||
TrEMBL | A0A1S4BI92 | 1e-71 | A0A1S4BI92_TOBAC; scarecrow-like protein 14 | ||||
STRING | XP_009606498.1 | 8e-71 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA276 | 24 | 191 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G07520.1 | 3e-46 | GRAS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|