PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Medtr5g093010.1 | ||||||||
Common Name | MTR_5g093010 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 146aa MW: 16601.8 Da PI: 8.6659 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 122.2 | 2.8e-38 | 5 | 105 | 1 | 101 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 +CaaCk +rr+C++dC+++pyfpa++p++fa vhk++G nv k+l++lp+ re+a+++l+ eA++r+++PvyG+vg+i+kl qq++ ++ael Medtr5g093010.1 5 RCAACKSQRRRCPSDCIFSPYFPANNPQRFASVHKIYGGGNVGKMLQQLPHYVREQAANTLYLEAQCRIQNPVYGCVGIISKLYQQIHDTEAEL 98 6********************************************************************************************* PP DUF260 95 allkeel 101 a++++++ Medtr5g093010.1 99 AKIQTQI 105 **99885 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 23.66 | 4 | 105 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 4.3E-38 | 5 | 102 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 146 aa Download sequence Send to blast |
MIYGRCAACK SQRRRCPSDC IFSPYFPANN PQRFASVHKI YGGGNVGKML QQLPHYVREQ 60 AANTLYLEAQ CRIQNPVYGC VGIISKLYQQ IHDTEAELAK IQTQIACHKL QNQQYEAGSN 120 FNLLPPQSSS MEQFQWPNQT PNWFN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-33 | 6 | 110 | 12 | 119 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-33 | 6 | 110 | 12 | 119 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Medtr5g093010.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CU179894 | 1e-160 | CU179894.1 Medicago truncatula chromosome 5 clone mth4-21m22, COMPLETE SEQUENCE. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003617566.1 | 1e-106 | LOB domain-containing protein 24 | ||||
Swissprot | P59467 | 5e-45 | LBD23_ARATH; LOB domain-containing protein 23 | ||||
Swissprot | P59468 | 5e-45 | LBD24_ARATH; LOB domain-containing protein 24 | ||||
TrEMBL | G7K3J3 | 1e-104 | G7K3J3_MEDTR; Lateral organ boundaries (LOB) domain protein | ||||
STRING | AET00525 | 1e-105 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3697 | 30 | 66 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G26660.1 | 2e-47 | LOB domain-containing protein 24 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Medtr5g093010.1 |
Entrez Gene | 11432491 |
Publications ? help Back to Top | |||
---|---|---|---|
|