PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Medtr5g046870.1 | ||||||||
Common Name | MTR_5g046870 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 115aa MW: 13024 Da PI: 8.8291 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 97.9 | 4.3e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtf+kRrng+lKKA+ELS LCdaeva+iifss+gklye++s Medtr5g046870.1 9 KRIENKINRQVTFAKRRNGMLKKAYELSLLCDAEVALIIFSSRGKLYEFCS 59 79***********************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.3E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.786 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.44E-43 | 2 | 78 | No hit | No description |
SuperFamily | SSF55455 | 9.68E-34 | 2 | 82 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.4E-33 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 6.9E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.4E-33 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.4E-33 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0048440 | Biological Process | carpel development | ||||
GO:0048441 | Biological Process | petal development | ||||
GO:0048442 | Biological Process | sepal development | ||||
GO:0048443 | Biological Process | stamen development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 115 aa Download sequence Send to blast |
MGRGKVELKR IENKINRQVT FAKRRNGMLK KAYELSLLCD AEVALIIFSS RGKLYEFCSG 60 TSMAKTIERY QRCSYGALEI NHQPEIETQV CEACVFRSQE STCSQSEGGR FVDR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 3e-21 | 1 | 93 | 1 | 87 | MEF2 CHIMERA |
6byy_B | 3e-21 | 1 | 93 | 1 | 87 | MEF2 CHIMERA |
6byy_C | 3e-21 | 1 | 93 | 1 | 87 | MEF2 CHIMERA |
6byy_D | 3e-21 | 1 | 93 | 1 | 87 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed early during flower development. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed mainly in carpels, and weakly in stamens. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Functions with SEPALLATA2/AGL4 and SEPALLATA3/AGL9 to ensure proper development of petals, stamens and carpels, and to prevent the indeterminate growth of the flower meristem. Forms a heterodimer via the K-box domain with AGAMOUS, that could be involved in genes regulation during floral meristem development. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Medtr5g046870.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CU459040 | 1e-98 | CU459040.2 Medicago truncatula chromosome 5 clone mte1-1e23, COMPLETE SEQUENCE. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024639715.1 | 3e-59 | MADS-box protein CMB1 | ||||
Swissprot | P29382 | 1e-46 | SEP1_ARATH; Developmental protein SEPALLATA 1 | ||||
TrEMBL | G7JY40 | 5e-78 | G7JY40_MEDTR; MADS-box transcription factor family protein | ||||
STRING | GLYMA02G13401.1 | 1e-53 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF119 | 33 | 360 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G15800.1 | 5e-49 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Medtr5g046870.1 |
Entrez Gene | 11425950 |
Publications ? help Back to Top | |||
---|---|---|---|
|