PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Medtr3g077240.1 | ||||||||
Common Name | ELP1, MTR_3g077240 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 193aa MW: 20821.4 Da PI: 7.8578 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 144.3 | 3.6e-45 | 10 | 108 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 +CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+k+l++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l++el Medtr3g077240.1 10 PCAACKFLRRKCMPGCIFAPYFPPEEPQKFANVHKIFGASNVTKILNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAISFLQRQVQRLQKEL 103 7********************************************************************************************* PP DUF260 95 allke 99 +++++ Medtr3g077240.1 104 DSANA 108 99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 27.786 | 9 | 110 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 4.6E-44 | 10 | 107 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 193 aa Download sequence Send to blast |
MASSSSYNSP CAACKFLRRK CMPGCIFAPY FPPEEPQKFA NVHKIFGASN VTKILNELLP 60 HQREDAVNSL AYEAEARVRD PVYGCVGAIS FLQRQVQRLQ KELDSANADL LRFAYNEISP 120 NSSLPPLPPL VVPASFHQSQ RQFSSRFGNG NVDGNGFYSS FPYAIPWIND TSSEDISGGV 180 GGRGGGVGGG NL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 9e-67 | 9 | 118 | 10 | 119 | LOB family transfactor Ramosa2.1 |
5ly0_B | 9e-67 | 9 | 118 | 10 | 119 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Mtr.25864 | 0.0 | leaf |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in a band of cells at the adaxial base of all lateral organs formed from the shoot apical meristem and at the base of lateral roots. {ECO:0000269|PubMed:12068116}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Medtr3g077240.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC140849 | 0.0 | AC140849.8 Medicago truncatula clone mth2-17f20, complete sequence. | |||
GenBank | AC147877 | 0.0 | AC147877.10 Medicago truncatula clone mth2-9b13, complete sequence. | |||
GenBank | CU234113 | 0.0 | CU234113.3 M.truncatula DNA sequence from clone MTH2-16M17 on chromosome 3, complete sequence. | |||
GenBank | JN412594 | 0.0 | JN412594.2 Medicago truncatula LOB domain protein mRNA, complete cds. | |||
GenBank | JQ653161 | 0.0 | JQ653161.1 Medicago truncatula elongated petiolule 1 (ELP1) gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003601210.2 | 1e-140 | LOB domain-containing protein 25 | ||||
Refseq | XP_024634900.1 | 1e-140 | LOB domain-containing protein 25 | ||||
Refseq | XP_024634901.1 | 1e-140 | LOB domain-containing protein 25 | ||||
Refseq | XP_024634902.1 | 1e-140 | LOB domain-containing protein 25 | ||||
Refseq | XP_024634903.1 | 1e-140 | LOB domain-containing protein 25 | ||||
Refseq | XP_024634904.1 | 1e-140 | LOB domain-containing protein 25 | ||||
Swissprot | Q9FML4 | 4e-72 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | H2D439 | 1e-139 | H2D439_MEDTR; Elongated petiolule 1 | ||||
STRING | AES71461 | 1e-136 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1091 | 34 | 112 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63090.4 | 1e-74 | LBD family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Medtr3g077240.1 |
Entrez Gene | 11426990 |
Publications ? help Back to Top | |||
---|---|---|---|
|