PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Medtr2g016030.1 | ||||||||
Common Name | MTR_2g016030 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 162aa MW: 18113.3 Da PI: 8.5805 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 124.8 | 2.8e-39 | 44 | 101 | 3 | 60 |
zf-Dof 3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 ek+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk k Medtr2g016030.1 44 EKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKSCQRYWTAGGALRNVPVGAGRRKAKP 101 7899***************************************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 1.0E-27 | 44 | 100 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 2.4E-32 | 45 | 100 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.379 | 47 | 101 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 49 | 85 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010214 | Biological Process | seed coat development | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 162 aa Download sequence Send to blast |
MAEVRKGEEN QGIKLFGTTI KLHGEELKEG EKESEDQTVE KKIEKIIPCP RCKSMETKFC 60 YFNNYNVNQP RHFCKSCQRY WTAGGALRNV PVGAGRRKAK PPGHEDSGSP ESCLYEAASS 120 DDGHNYLGLE QFMPPQSDFR EVFSGKRRRK TSGGYSLASS L* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Mtr.17949 | 0.0 | leaf| root |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Acts as a negative regulator in the phytochrome-mediated light responses. Controls phyB-mediated end-of-day response and the phyA-mediated anthocyanin accumulation. Not involved in direct flowering time regulation. {ECO:0000269|PubMed:19619493}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00166 | DAP | Transfer from AT1G29160 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Medtr2g016030.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By red or far-red light. Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013462554.1 | 1e-118 | dof zinc finger protein DOF1.5 | ||||
Swissprot | P68350 | 1e-45 | DOF15_ARATH; Dof zinc finger protein DOF1.5 | ||||
TrEMBL | A0A072V3I5 | 1e-117 | A0A072V3I5_MEDTR; Dof domain zinc finger protein | ||||
STRING | XP_004485893.1 | 3e-71 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6483 | 32 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G29160.1 | 3e-45 | Dof family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Medtr2g016030.1 |
Entrez Gene | 25485958 |
Publications ? help Back to Top | |||
---|---|---|---|
|