PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Medtr1g111830.1 | ||||||||
Common Name | MTR_077s0043, MTR_1g111830 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 245aa MW: 27600.6 Da PI: 6.6103 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 24.8 | 4.9e-08 | 23 | 66 | 3 | 44 |
SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44 WT + d+l+ +a + + + +W++Ia+ ++ g+++ ++++++ Medtr1g111830.1 23 QWTRDHDKLFERALLMVPEDlpdRWEKIAEQVP-GKSAAEIRDHY 66 6*****************99*************.**********9 PP | |||||||
2 | Myb_DNA-binding | 45.5 | 1.8e-14 | 125 | 169 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ l++ + +++G+g+W++I+r + +Rt+ q+ s+ qky Medtr1g111830.1 125 PWTEEEHRLFLIGLTKFGKGDWRSISRNVVVTRTPTQVASHAQKY 169 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51293 | 6.84 | 19 | 76 | IPR017884 | SANT domain |
SMART | SM00717 | 7.3E-6 | 20 | 72 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 6.06E-11 | 22 | 78 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 7.1E-5 | 23 | 70 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 2.4E-7 | 23 | 67 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.98E-6 | 24 | 70 | No hit | No description |
PROSITE profile | PS51294 | 20.667 | 118 | 174 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.7E-17 | 120 | 175 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 3.2E-17 | 121 | 173 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 3.9E-11 | 122 | 168 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.1E-10 | 122 | 172 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 6.47E-9 | 125 | 170 | No hit | No description |
Pfam | PF00249 | 1.6E-11 | 125 | 169 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 245 aa Download sequence Send to blast |
MYRESVAMAT TTAATRWPTQ PTQWTRDHDK LFERALLMVP EDLPDRWEKI AEQVPGKSAA 60 EIRDHYEALV HDILEIDSGR VEVPSYSDES AVSGGGLAEW DSSNQISFGS KPRHGGDNER 120 KKGTPWTEEE HRLFLIGLTK FGKGDWRSIS RNVVVTRTPT QVASHAQKYF LRQNSVKKER 180 KRSSIHDITS VDSNSAPVPI DQNWVPPPGG GSMQQQSPEM HHYPSNNLQD QMSAYGYSNY 240 GFQM* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 3e-14 | 13 | 97 | 2 | 80 | RADIALIS |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in young seedlings, developing leaves, sepals and trichomes. {ECO:0000269|PubMed:26243618}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00055 | PBM | Transfer from AT5G04760 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Medtr1g111830.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC235008 | 0.0 | AC235008.3 Medicago truncatula clone mth2-151p16, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013470249.1 | 0.0 | transcription factor DIVARICATA | ||||
Swissprot | Q9FNN6 | 2e-59 | SRM1_ARATH; Transcription factor SRM1 | ||||
TrEMBL | G7ZYT0 | 0.0 | G7ZYT0_MEDTR; MYB-like transcription factor family protein | ||||
STRING | AES84368 | 0.0 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6068 | 32 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G04760.1 | 3e-81 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Medtr1g111830.1 |
Entrez Gene | 25485559 |
Publications ? help Back to Top | |||
---|---|---|---|
|