PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Medtr1g085880.1 | ||||||||
Common Name | MTR_055s0001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 194aa MW: 22605.4 Da PI: 9.736 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.3 | 2.6e-16 | 17 | 61 | 4 | 48 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 W++eEde+l+ +v+++G+g+Wk +++ g+ ++++c+ rw++ l Medtr1g085880.1 17 WSKEEDEILKAYVEKHGTGNWKEVSKNTGLAHCGNSCRFRWYNTL 61 ******************************************975 PP | |||||||
2 | Myb_DNA-binding | 46.3 | 9.9e-15 | 67 | 110 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +g++++eE+e++ +++ ++G W++ a +m+ gRt++++k++w+ Medtr1g085880.1 67 KGPFSKEEEEKFFELFSKFGEFKWSKMALEMP-GRTDNDIKNFWN 110 79******************99**********.***********8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 23.818 | 8 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 2.0E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 3.56E-25 | 13 | 109 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.37E-12 | 17 | 61 | No hit | No description |
Pfam | PF13921 | 1.1E-15 | 17 | 77 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 8.9E-21 | 17 | 67 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.4E-14 | 66 | 115 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 16.616 | 66 | 117 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.4E-20 | 68 | 115 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 194 aa Download sequence Send to blast |
MPSSSDTNKR LKKGTLWSKE EDEILKAYVE KHGTGNWKEV SKNTGLAHCG NSCRFRWYNT 60 LRPDLRKGPF SKEEEEKFFE LFSKFGEFKW SKMALEMPGR TDNDIKNFWN ARKRKHQRHC 120 LSPFPDNNME LVDGLNSSNG KRIRNSQENK FKIPEVIKFG NQILHTNLFD DSNMFFNNVG 180 STSTCNHTTS TLID |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 1e-18 | 8 | 115 | 22 | 126 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Accumulates in the pollen tube nucleus during pollen tube growth through the pistil. {ECO:0000269|PubMed:23791732}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in pollen grains and pollen tube (PubMed:23791732, PubMed:24278028). Mostly expressed in mature pollen grains, and, to a lower extent, in inflorescences and siliques (PubMed:24278028). {ECO:0000269|PubMed:23791732, ECO:0000269|PubMed:24278028}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator (PubMed:24278028). Binds to 5'-CAACTGTC-3' and/or 5'-TAACAAA-3' motif in target gene promoter to promote their expression (By similarity). Together with MYB97 and MYB101, functions as a male factor that controls pollen tube-synergid interaction in fertilization. Required for pollen tube growth arrest and sperm cell release in the female gametophyte, probably via the regulation of pollen tube-specific gene expression (PubMed:24278028, PubMed:23791732). {ECO:0000250|UniProtKB:O80883, ECO:0000269|PubMed:23791732, ECO:0000269|PubMed:24278028}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Medtr1g085880.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates in pollen tube 4 hours after pollen germination. {ECO:0000269|PubMed:19714218}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CR931733 | 3e-60 | CR931733.2 Medicago truncatula chromosome 5 clone mth2-38a4, COMPLETE SEQUENCE. | |||
GenBank | CR954185 | 3e-60 | CR954185.3 Medicago truncatula chromosome 5 clone mth4-20m5, COMPLETE SEQUENCE. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013469147.2 | 1e-142 | transcription factor MYB87 | ||||
Refseq | XP_024630837.1 | 1e-143 | transcription factor WER | ||||
Swissprot | Q94FL7 | 3e-37 | MY120_ARATH; Transcription factor MYB120 | ||||
TrEMBL | A0A072VME4 | 1e-141 | A0A072VME4_MEDTR; Myb DNA-binding domain protein | ||||
TrEMBL | A0A072VYM8 | 1e-141 | A0A072VYM8_MEDTR; Myb DNA-binding domain protein (Fragment) | ||||
STRING | AES61546 | 1e-137 | (Medicago truncatula) | ||||
STRING | AES83889 | 1e-143 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF15637 | 2 | 11 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G26960.1 | 6e-31 | myb domain protein 81 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Medtr1g085880.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|