PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Medtr1g084060.2 | ||||||||
Common Name | MTR_1g084060 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 269aa MW: 30856.9 Da PI: 5.4374 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 27.6 | 5e-09 | 210 | 244 | 21 | 55 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 + +yp++ee+ +L++ +gL+ +q+ +WF N+R ++ Medtr1g084060.2 210 RWPYPTEEEKLQLSDMTGLDIKQINNWFINQRKRH 244 569*****************************885 PP | |||||||
2 | ELK | 39.7 | 1e-13 | 164 | 185 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK++LlrKY+gyL++L+qEF+ Medtr1g084060.2 164 ELKEMLLRKYGGYLSNLRQEFL 185 9********************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01255 | 7.6E-19 | 17 | 61 | IPR005540 | KNOX1 |
Pfam | PF03790 | 1.2E-19 | 19 | 60 | IPR005540 | KNOX1 |
SMART | SM01256 | 1.6E-23 | 64 | 115 | IPR005541 | KNOX2 |
Pfam | PF03791 | 2.9E-23 | 67 | 114 | IPR005541 | KNOX2 |
SMART | SM01188 | 3.2E-7 | 164 | 185 | IPR005539 | ELK domain |
PROSITE profile | PS51213 | 11.453 | 164 | 184 | IPR005539 | ELK domain |
Pfam | PF03789 | 1.2E-10 | 164 | 185 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.341 | 184 | 247 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 2.99E-19 | 186 | 256 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 8.7E-13 | 186 | 251 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 3.9E-27 | 189 | 249 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 1.61E-11 | 196 | 248 | No hit | No description |
Pfam | PF05920 | 3.9E-17 | 204 | 243 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 222 | 245 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 269 aa Download sequence Send to blast |
MEHNRSDLIR LDMTTDRIIK NQIATHPLYP NLLSAFLECQ KVGAPTELAS LLEEIGRESH 60 PNNAFREIGD DPDLDHFMES YCEVLHRYKE ELSKPLNEAT LFLCNIESQL NELCKGTQTM 120 SSDYNRSDHE AAGTSEDEMS CGKVEAVEGG HDELCGTSCP GDKELKEMLL RKYGGYLSNL 180 RQEFLKKRKK GKLPKDARKA LMDWWNVHYR WPYPTEEEKL QLSDMTGLDI KQINNWFINQ 240 RKRHWKPSED MRFSIMEGVS STGIAGPL* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 179 | 188 | LRQEFLKKRK |
2 | 185 | 189 | KKRKK |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Highly expressed in the early globular stage embryo before 2 days after pollination (DAP), but not in the endosperm. At 3 and 4 DAP, expression is restricted to the region around or just below the center of the ventral side of the embryo, where the shoot apex subsequently arises. During the transition to the shoot apex differentiation stage, expression is divided between the upper and basal regions of the shoot area, and the notch between the first leaf primordium and epiblast, respectively. When the first leaf primordia is evident, expression is localized to the notches between the shoot apical meristem (SAM) and the first leaf primordium and the putative second leaf primordium. Expressed uniformly in the inflorescence meristem, but after the transition from inflorescence to the floral phase, located specifically in the notches between the floral meristem and glume primordia. At later stages of flower development, uniformly expressed throughout the corpus of the meristem, and in the notches between glume primordia, but less well defined than in the previous stage. {ECO:0000269|PubMed:10488233}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may be involved in shoot formation during early embryogenesis. {ECO:0000269|PubMed:10488233}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Medtr1g084060.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KT363851 | 0.0 | KT363851.1 Pisum sativum line SGE class I knotted-1-like 8 homeobox transcription factor (KNOX8) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024638687.1 | 0.0 | homeobox protein knotted-1-like 10 | ||||
Swissprot | Q9FP29 | 2e-88 | KNOS1_ORYSJ; Homeobox protein knotted-1-like 1 | ||||
TrEMBL | A0A072VNV2 | 0.0 | A0A072VNV2_MEDTR; Homeobox knotted-like protein | ||||
TrEMBL | G7I9I1 | 0.0 | G7I9I1_MEDTR; Homeobox knotted-like protein | ||||
STRING | AES61472 | 0.0 | (Medicago truncatula) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G23380.1 | 2e-78 | KNOTTED1-like homeobox gene 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Medtr1g084060.2 |
Entrez Gene | 11406488 |
Publications ? help Back to Top | |||
---|---|---|---|
|