PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g041615.1
Common NameMTR_1g041615
Organism
Medicago truncatula
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family M-type_MADS
Protein Properties Length: 136aa    MW: 15741.4 Da    PI: 9.8033
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g041615.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.42.5e-301363151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     k+ien  nr+vtfskRrng++KKA+ELS+LCdaevavi+fs+tgklye+ss
  Medtr1g041615.1 13 KKIENLNNRKVTFSKRRNGLFKKAQELSILCDAEVAVIVFSTTGKLYEFSS 63
                     68***********************************************96 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.198565IPR002100Transcription factor, MADS-box
SMARTSM004321.5E-36564IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-27727IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.4E-29887IPR002100Transcription factor, MADS-box
PfamPF003192.4E-271461IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-272742IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-274263IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009910Biological Processnegative regulation of flower development
GO:0048577Biological Processnegative regulation of short-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 136 aa     Download sequence    Send to blast
MVRKIEIKKI EIKKIENLNN RKVTFSKRRN GLFKKAQELS ILCDAEVAVI VFSTTGKLYE  60
FSSTRDCSRI FHFVFKFIDM QDQEAMAEIK ALRKQLEEIE NKSKVEFKEI DPLDRGTASI  120
NSSNPPLEPY LLLRL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A2e-16864460MEF2C
5f28_B2e-16864460MEF2C
5f28_C2e-16864460MEF2C
5f28_D2e-16864460MEF2C
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During the reproductive phase, accumulates in immature buds and at the base of the floral organs, and in the receptacle, ovules, anther filaments, and stigma and style of open flowers. Accumulates before fertilization in the cytoplasm in the cells of the egg apparatus and moves into the nucleus during early stages of development following fertilization in the suspensor, embryo, and endosperm, mainly double fertilization derived tissues (at protein level). Highly expressed in developing embryos. In young seedlings, present in the shoot and root apices, lateral root primordia and throughout the vascular system. {ECO:0000269|PubMed:10318690, ECO:0000269|PubMed:10662856, ECO:0000269|PubMed:15686521, ECO:0000269|PubMed:17521410, ECO:0000269|PubMed:8953767}.
UniprotTISSUE SPECIFICITY: Expressed at low levels in flowers and siliques. Also present in seedlings. Detected during embryogenesis and accumulates during early seed development (at protein level). Expressed in shoot apices and the base of leaf petioles. {ECO:0000269|PubMed:10318690, ECO:0000269|PubMed:10662856, ECO:0000269|PubMed:12837945, ECO:0000269|PubMed:12949148, ECO:0000269|PubMed:15686521, ECO:0000269|PubMed:16028119, ECO:0000269|PubMed:17521410, ECO:0000269|PubMed:8953767}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway. Acts as both an activator and a repressor of transcription. Binds DNA in a sequence-specific manner in large CArG motif 5'-CC (A/T)8 GG-3'. Participates probably in the regulation of programs active during the early stages of embryo development. Prevents premature perianth senescence and abscission, fruits development and seed desiccation. Stimulates the expression of at least DTA4, LEC2, FUS3, ABI3, AT4G38680/CSP2 and GRP2B/CSP4. Can enhance somatic embryo development in vitro. {ECO:0000269|PubMed:10318690, ECO:0000269|PubMed:10662856, ECO:0000269|PubMed:12226488, ECO:0000269|PubMed:12743119, ECO:0000269|PubMed:14615187, ECO:0000269|PubMed:15084721, ECO:0000269|PubMed:15686521, ECO:0000269|PubMed:17521410, ECO:0000269|PubMed:18305206, ECO:0000269|PubMed:19269998, ECO:0000269|PubMed:19767455, ECO:0000269|PubMed:8953767}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr1g041615.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin (2,4-D). Feedback loop leading to direct down-regulation by itself. {ECO:0000269|PubMed:15686521}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025015594.18e-28LOW QUALITY PROTEIN: agamous-like MADS-box protein AGL18
SwissprotQ388473e-25AGL15_ARATH; Agamous-like MADS-box protein AGL15
TrEMBLA0A072VSH92e-92A0A072VSH9_MEDTR; MADS-box transcription factor family protein
STRINGAES667062e-91(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13790.11e-22AGAMOUS-like 15
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Zheng Q,Zheng Y,Perry SE
    Decreased GmAGL15 expression and reduced ethylene synthesis may contribute to reduced somatic embryogenesis in a poorly embryogenic cultivar of Glycine max.
    Plant Signal Behav, 2014.
    [PMID:23838957]
  3. Perry SE,Zheng Q,Zheng Y
    Transcriptome analysis indicates that GmAGAMOUS-Like 15 may enhance somatic embryogenesis by promoting a dedifferentiated state.
    Plant Signal Behav, 2016. 11(7): p. e1197463
    [PMID:27302197]
  4. Cosio C, et al.
    The class III peroxidase PRX17 is a direct target of the MADS-box transcription factor AGAMOUS-LIKE15 (AGL15) and participates in lignified tissue formation.
    New Phytol., 2017. 213(1): p. 250-263
    [PMID:27513887]
  5. Zheng Q,Zheng Y,Ji H,Burnie W,Perry SE
    Gene Regulation by the AGL15 Transcription Factor Reveals Hormone Interactions in Somatic Embryogenesis.
    Plant Physiol., 2016. 172(4): p. 2374-2387
    [PMID:27794101]
  6. Chen N,Veerappan V,Abdelmageed H,Kang M,Allen RD
    HSI2/VAL1 Silences AGL15 to Regulate the Developmental Transition from Seed Maturation to Vegetative Growth in Arabidopsis.
    Plant Cell, 2018. 30(3): p. 600-619
    [PMID:29475938]