PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 88104 | ||||||||
Common Name | MICPUN_88104 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 172aa MW: 20290.1 Da PI: 10.3789 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.9 | 5.6e-19 | 11 | 57 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT++Ed++l +av+q+ g++Wk+Ia+++ Rt+ qc +rwqk+l 88104 11 KGGWTPDEDDILRRAVAQYKGKNWKKIAEYFE-ERTDVQCLHRWQKVL 57 688*****************************.************986 PP | |||||||
2 | Myb_DNA-binding | 65.3 | 1.1e-20 | 63 | 109 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++++++v qlG ++W++Ia+ ++ gR +kqc++rw+++l 88104 63 KGPWTKEEDDKIIELVGQLGAKQWSKIAQQLP-GRIGKQCRERWYNHL 109 79******************************.*************97 PP | |||||||
3 | Myb_DNA-binding | 55.2 | 1.6e-17 | 115 | 159 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r W+ eEd +l+ a++q+G++ W+ Ia+t+ gRt++ +k++w++ 88104 115 REEWSREEDRKLIIAHHQFGNR-WAEIAKTFV-GRTDNAIKNHWNST 159 789*******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 18.105 | 6 | 57 | IPR017930 | Myb domain |
SMART | SM00717 | 7.6E-16 | 10 | 59 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.6E-17 | 11 | 57 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.51E-16 | 12 | 67 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 2.2E-24 | 13 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.18E-12 | 14 | 57 | No hit | No description |
PROSITE profile | PS51294 | 31.94 | 58 | 113 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.02E-30 | 60 | 156 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.7E-18 | 62 | 111 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.5E-19 | 63 | 109 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.40E-14 | 65 | 109 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.2E-27 | 69 | 112 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 5.7E-23 | 113 | 164 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.2E-14 | 114 | 162 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 22.945 | 114 | 164 | IPR017930 | Myb domain |
Pfam | PF00249 | 2.3E-14 | 115 | 159 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.02E-9 | 117 | 160 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 172 aa Download sequence Send to blast |
RIGGPTRRSA KGGWTPDEDD ILRRAVAQYK GKNWKKIAEY FEERTDVQCL HRWQKVLNPE 60 LVKGPWTKEE DDKIIELVGQ LGAKQWSKIA QQLPGRIGKQ CRERWYNHLN PEIKREEWSR 120 EEDRKLIIAH HQFGNRWAEI AKTFVGRTDN AIKNHWNSTL KRKVDEALAR GL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h88_C | 2e-69 | 10 | 164 | 5 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 2e-69 | 10 | 164 | 5 | 159 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (By similarity). Transcription repressor that regulates organ growth. Binds to the promoters of G2/M-specific genes and to E2F target genes to prevent their expression in post-mitotic cells and to restrict the time window of their expression in proliferating cells (PubMed:26069325). {ECO:0000250|UniProtKB:Q94FL9, ECO:0000269|PubMed:26069325}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00482 | DAP | Transfer from AT5G02320 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by ethylene and salicylic acid (SA). {ECO:0000269|PubMed:16463103}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CP001332 | 0.0 | CP001332.1 Micromonas sp. RCC299 chromosome 14, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002505942.1 | 1e-124 | predicted protein, partial | ||||
Swissprot | Q6R032 | 3e-84 | MB3R5_ARATH; Transcription factor MYB3R-5 | ||||
TrEMBL | C1EGX6 | 1e-122 | C1EGX6_MICCC; Uncharacterized protein (Fragment) | ||||
STRING | XP_002505942.1 | 1e-123 | (Micromonas sp. RCC299) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP15 | 16 | 114 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G02320.2 | 1e-86 | myb domain protein 3r-5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 88104 |
Entrez Gene | 8249077 |
Publications ? help Back to Top | |||
---|---|---|---|
|