PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 83790 | ||||||||
Common Name | MICPUN_83790 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 132aa MW: 15286.3 Da PI: 10.4681 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 53.3 | 6.3e-17 | 32 | 78 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT+eEd l+++v+++G++ W++Iar + R +kqc++rw+++l 83790 32 KGGWTPEEDAHLLRLVEEHGTKEWSKIARLLH-MRAGKQCRERWHNHL 78 688*****************************.*************97 PP | |||||||
2 | Myb_DNA-binding | 62 | 1.2e-19 | 84 | 126 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 rg+WT+eE+ l+ a+++lG++ W+ Ia++++ gRt++ +k++w+ 83790 84 RGPWTEEEERALIAAHEKLGNR-WADIAAEIP-GRTENAVKNHWN 126 89********************.*********.***********8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.982 | 27 | 78 | IPR017930 | Myb domain |
SMART | SM00717 | 7.1E-13 | 31 | 80 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.76E-31 | 31 | 125 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 3.0E-28 | 34 | 85 | IPR009057 | Homeodomain-like |
Pfam | PF13921 | 3.5E-20 | 35 | 95 | No hit | No description |
CDD | cd00167 | 5.47E-12 | 35 | 78 | No hit | No description |
PROSITE profile | PS51294 | 27.399 | 79 | 132 | IPR017930 | Myb domain |
SMART | SM00717 | 2.5E-18 | 83 | 131 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.9E-23 | 86 | 131 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.64E-12 | 86 | 126 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010439 | Biological Process | regulation of glucosinolate biosynthetic process | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:1904095 | Biological Process | negative regulation of endosperm development | ||||
GO:2000692 | Biological Process | negative regulation of seed maturation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 132 aa Download sequence Send to blast |
MLGESEPSSP YGTREVPQKR YLKTKGGGLK IKGGWTPEED AHLLRLVEEH GTKEWSKIAR 60 LLHMRAGKQC RERWHNHLQP NIKRGPWTEE EERALIAAHE KLGNRWADIA AEIPGRTENA 120 VKNHWNATNR RR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1mse_C | 8e-42 | 29 | 132 | 1 | 104 | C-Myb DNA-Binding Domain |
1msf_C | 8e-42 | 29 | 132 | 1 | 104 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that recognizes the motif 5'-TAACGG-3' in the promoter of endosperm-induced genes (PubMed:27681170, PubMed:25194028, PubMed:19066902). Promotes vegetative-to-embryonic transition and the formation of somatic embryos from root explants in a WUS-independent manner but via the expression of embryonic genes (e.g. LEC1, LEC2, FUS3 and WUS) (PubMed:18695688). May play an important role during embryogenesis and seed maturation (PubMed:19066902, PubMed:25194028). Together with MYB115, activates the transcription of S-ACP-DES2/AAD2 and S-ACP-DES3/AAD3 thus promoting the biosynthesis of omega-7 monounsaturated fatty acid in seed endosperm (PubMed:27681170). Regulates negatively maturation genes in the endosperm (PubMed:25194028). {ECO:0000269|PubMed:18695688, ECO:0000269|PubMed:19066902, ECO:0000269|PubMed:25194028, ECO:0000269|PubMed:27681170}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00385 | DAP | Transfer from AT3G27785 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by LEC2. {ECO:0000269|PubMed:25194028}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CP001328 | 1e-145 | CP001328.1 Micromonas sp. RCC299 chromosome 7, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002503839.1 | 5e-92 | predicted protein, partial | ||||
Swissprot | Q9LVW4 | 1e-44 | MY118_ARATH; Transcription factor MYB118 | ||||
TrEMBL | C1E9V1 | 1e-90 | C1E9V1_MICCC; Uncharacterized protein (Fragment) | ||||
STRING | XP_002503839.1 | 2e-91 | (Micromonas sp. RCC299) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP15 | 16 | 114 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G27785.1 | 4e-45 | myb domain protein 118 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 83790 |
Entrez Gene | 8244778 |
Publications ? help Back to Top | |||
---|---|---|---|
|