PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 105585
Common NameMICPUN_105585
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas
Family GATA
Protein Properties Length: 289aa    MW: 30364.9 Da    PI: 9.6054
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
105585genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA603.1e-19154187134
    GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
             C+nC+t+kTplWR+gp g+ktLCnaCG+++++ +
  105585 154 CANCRTSKTPLWRNGPLGPKTLCNACGVRFKLGK 187
             *******************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011414.615148191IPR000679Zinc finger, GATA-type
SMARTSM004011.4E-12148210IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.19E-13150191No hitNo description
Gene3DG3DSA:3.30.50.101.7E-16152190IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.06E-15153185No hitNo description
PfamPF003201.2E-16154187IPR000679Zinc finger, GATA-type
PROSITE patternPS003440154179IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MATSGQQPPE AAHAPPQSAA QAQANAYHEQ MKANYAAAYA ANPYLLHPQI MAMNAFASAA  60
NPHPPNLVEV QTLLKRYEHM TQGMQKVPSL KELNARAPPY APPGVADAAH INALPPAVKV  120
PPAVAAPNEE PNAVAGAGEE DAEGMPAPCA GKVCANCRTS KTPLWRNGPL GPKTLCNACG  180
VRFKLGKLPP PGGWPPGHVP PPAPPRKRPA LLDSNGQPVK RSKAEKGALL EKDGEKVKKK  240
RRPRLAPDLE AEEGGEYLRA GKVAKTTALL TDYDGAVLLM VLAGMYSH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1235243KVKKKRRPR
2237241KKKRR
3237242KKKRRP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00530DAPTransfer from AT5G25830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0013260.0CP001326.1 Micromonas sp. RCC299 chromosome 5, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002502132.10.0predicted protein
TrEMBLC1E6990.0C1E699_MICCC; Uncharacterized protein
STRINGXP_002502132.10.0(Micromonas sp. RCC299)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP43691012
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36620.17e-14GATA transcription factor 19
Publications ? help Back to Top
  1. Worden AZ, et al.
    Green evolution and dynamic adaptations revealed by genomes of the marine picoeukaryotes Micromonas.
    Science, 2009. 324(5924): p. 268-72
    [PMID:19359590]