PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 105435
Common NameMICPUN_105435
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas
Family GATA
Protein Properties Length: 197aa    MW: 20863.2 Da    PI: 7.4233
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
105435genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA49.55.8e-16107140134
    GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
             C +Cg+ ++p+WRrgp  +++LCnaCG +yr+++
  105435 107 CDHCGAVDSPQWRRGPASKPMLCNACGTRYRRTN 140
             9***************99999**********875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.321101160IPR000679Zinc finger, GATA-type
SuperFamilySSF577166.18E-12101146No hitNo description
SMARTSM004011.0E-6101152IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.107.3E-12101144IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.02E-11106146No hitNo description
PfamPF003202.1E-13107139IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MVTAGLHATS MGAKSNGSTN KQWYSLVKLD PYGLGHGACD GELAELEELI LSEPDQRGLD  60
DGTFTGFHGS DGDANSSLSD DAEDDSRDDY RVYKAMPPVH QKPGGPCDHC GAVDSPQWRR  120
GPASKPMLCN ACGTRYRRTN NLGPSTPMGR VGQAALPKKR TPPGSPTSSL NPAKKNRCAP  180
TEITGIENLR PNAVRA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0013250.0CP001325.1 Micromonas sp. RCC299 chromosome 4, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002501737.11e-144predicted protein
TrEMBLC1E3T91e-143C1E3T9_MICCC; Uncharacterized protein
STRINGXP_002501737.11e-144(Micromonas sp. RCC299)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP4501526
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.14e-12GATA transcription factor 26
Publications ? help Back to Top
  1. Worden AZ, et al.
    Green evolution and dynamic adaptations revealed by genomes of the marine picoeukaryotes Micromonas.
    Science, 2009. 324(5924): p. 268-72
    [PMID:19359590]