PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 60557
Common NameMICPUCDRAFT_60557
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas; Micromonas pusilla
Family G2-like
Protein Properties Length: 533aa    MW: 53286.2 Da    PI: 5.734
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
60557genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like932.4e-29253306155
  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
              +prl+Wtp LH+rFv+av++L G+ +A+Pkti++lm+v+gLt+e+v+SHLQkYRl
    60557 253 RPRLVWTPPLHKRFVDAVSHL-GIRNAVPKTIMQLMNVDGLTRENVASHLQKYRL 306
              59*******************.9*******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.635250309IPR017930Myb domain
SuperFamilySSF466896.27E-19251310IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-29252311IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-23254306IPR006447Myb domain, plants
PfamPF002491.4E-6256305IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 533 aa     Download sequence    Send to blast
MKPEGAKAPA EETQNAEKGN ARGESLAKEA EEWAMAARKR AVTIDASIPP PDSRLLSSQM  60
ASAFGIQLMN AQYRYPHAPP PPVSGGTRDS RGSRGSEYTN APPSANFDPN AGMPRPPMPP  120
PYAGFAHQQP GAPGHANAQA QQAAAAAAAA AISNMYGYHG LAQWNANAFS NAQGGGHPRG  180
MYPHEMYGRR PDAGPGIGAA QGHMDPSVSY EQMMAYQAGV EHSRSFEAFK RSREEAMSHH  240
LDGSEDDAQA LKRPRLVWTP PLHKRFVDAV SHLGIRNAVP KTIMQLMNVD GLTRENVASH  300
LQKYRLYLKR LHGGCSESTM ENSPSGEGGG SGGGSEGDGS GGGVGDDGDG DAKRRDAKDN  360
SGDGGSADGS GGGSDGSGKG HQTSEKGSGG GGSDGGGSDG ERNGSGDGSG QGSGAGGERD  420
ARARTDSGSG GGGGGATKTT GGVVVTGARP SDEITRGPSG GIADAGAGGS GGGSGGDDGG  480
DDDAARPDSC ERPSSGDESN DGERNGGDPA TTQGAPNAAG AGAGEKGGKG GK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A2e-31253309157Transcription factor LUX
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1324334SGEGGGSGGGS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003061130.10.0g2-like myb-family transcription factor
TrEMBLC1MZ060.0C1MZ06_MICPC; G2-like myb-family transcription factor
STRINGXP_003061130.10.0(Micromonas pusilla)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1111645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.22e-35G2-like family protein
Publications ? help Back to Top
  1. Worden AZ, et al.
    Green evolution and dynamic adaptations revealed by genomes of the marine picoeukaryotes Micromonas.
    Science, 2009. 324(5924): p. 268-72
    [PMID:19359590]