PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 53335
Common NameMICPUCDRAFT_53335
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas; Micromonas pusilla
Family SBP
Protein Properties Length: 783aa    MW: 79680.1 Da    PI: 6.7581
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
53335genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP35.42.9e-113744232372
            --HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT----- CS
    SBP  23 vCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhner 72 
             C +h  a++vl+ g+  r Cq C  fh lsef ++ ++C rrL++   r
  53335 374 TCPMHLDATTVLIGGIPSRECQACRAFHPLSEFGKDNKTCERRLKRKKVR 423
            59******************************************998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114114.238343427IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.102.3E-11344414IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.92E-11346423IPR004333Transcription factor, SBP-box
PfamPF031102.2E-14372425IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 783 aa     Download sequence    Send to blast
MTAGLAASVT QRETRTAIAM QVAEAETRGG EPSARRPRKG HAPRATTKTA PSATDVEIDV  60
LAPATDEKEV SDTPSRGPAD GVAGPPRGYR DLADVDDPAK NENADAREDD REDDAAADDD  120
DDARETTETM GQTVTTAVPA AAARPPVNVE DDDAEDDDDA TARSEEDVER NAVAASPTYA  180
ARGPSGATAT GTATMTREEL VGGLGGGDDG GKPNTPGSVH KPVGRPMNVV SSPSATVNAD  240
GSLRSERLAA ARTLLAAPAP PGGVGVAATA DRSTEDAAAD AEARWRALTA AAEAPPLYHI  300
TPAADELANA GGGGGGGGGL KYGEMGSRSK ASAQGWVHRV RVKKKCVVDD CARFRVAPEG  360
VGSRHNGKIR LPLTCPMHLD ATTVLIGGIP SRECQACRAF HPLSEFGKDN KTCERRLKRK  420
KVRYHMSATG SDFTDAEAEA AALALVEKAG DRRVPVFSAA SLKRGGGSGG GGGFRLLGGH  480
PKKKRTGVTP GPVREKIRSE AKQIAAGLPG SFPAPPRSTA DDDDADAGLL ERYSSLRGSM  540
PRDASLHEAA ARGAARGFHD AVTNAVTNAV TSANDAGYAH QPALAELGRR QQPPPSAPPP  600
PRASSPNPGQ SPAQQAAATL AAQCLMAAST LLSQVASSPA AAAAAPPPPA PATQSSPAGA  660
LIAALHQQRQ SAAGAGANLA ALLAAGGLPG AGGAGGDGGG VGGLSADALE AMRAAQARAD  720
AANEAADRAN GDVQKQLSDA QVRSTQKFFT HRPVSTFDRF PFQLTGELFL YGMALRRRRG  780
AG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1414421RRLKRKKV
2415422RLKRKKVR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7543571e-44KF754357.1 Micromonas pusilla strain CCMP1545 phytochrome (PHY) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003063554.10.0predicted protein
TrEMBLC1N6J20.0C1N6J2_MICPC; Predicted protein
STRINGXP_003063554.10.0(Micromonas pusilla)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1069424
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60030.12e-08squamosa promoter-binding protein-like 12
Publications ? help Back to Top
  1. Worden AZ, et al.
    Green evolution and dynamic adaptations revealed by genomes of the marine picoeukaryotes Micromonas.
    Science, 2009. 324(5924): p. 268-72
    [PMID:19359590]