PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 53007
Common NameMICPUCDRAFT_53007
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas; Micromonas pusilla
Family Nin-like
Protein Properties Length: 1323aa    MW: 135056 Da    PI: 6.3801
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
53007genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK76.14.2e-24663710451
  RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiks 51 
              ++le+l+++Fs+++k+AAk+Lgv+ T+LKriCR+yGI RWP+R +ks
   53007 663 GVTLEMLQQHFSKHLKQAAKDLGVGSTTLKRICRRYGITRWPRRSLKS 710
             689*******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.097645731IPR003035RWP-RK domain
PfamPF020421.4E-21664710IPR003035RWP-RK domain
PROSITE profilePS5174512.33111011182IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2404.4E-811141182No hitNo description
SMARTSM006663.511141197IPR000270PB1 domain
CDDcd059923.53E-511171179No hitNo description
SuperFamilySSF542771.73E-811181180No hitNo description
PfamPF005642.6E-511451177IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2407.2E-812421308No hitNo description
SuperFamilySSF542771.41E-712431311No hitNo description
SMARTSM006660.4212441320IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1323 aa     Download sequence    Send to blast
MPRKSAAAAP PPPRADDVAN DPDLADFLKQ LVNVDDAGGD RFLHPRGAAN PDAVWSDLDN  60
LDVADNIDVS LGASGGALGA VAAAGHVRAR AVDSPSLASV ASADVRRGGE RVAVARAARD  120
ASDDKIGNDA RDSDSPASVG GDLATGSGGS GGTGSSATSA VKTLEHLGET LRVLSDQLRA  180
AQARSISRRF PYDRVGVRPH ESPPDASGAD RTAEATQRRL ASTLNDISER LDVGSLVQLF  240
VPKLQSRPGG ALVMLQTFKA FTRVKTVHQE KFWKYHRLSE GFFFNLSPGG DSNLLGLPGR  300
CFLHSRAEWT PSVCCYQPTE YPRLGCAIEC QMHSTIALPV YFDDPRVRPA LPFAVMELLL  360
DQQVTDMGRV FSICVGALRE NGLYTAGTDR LGTEDTMRAA LGSKLSRVGE GNDVALENMC  420
HALGFPLAQC WIPNDDGLLI AAGAPYCVKD AMAFPFRQIS SQISLLSGQG PVGQAHEQGT  480
MIWIDDVQNG SQLDWPLQHA TALLGLHGAC TCKILLHQKP NRGGCGGEPI EAVLEVILPS  540
NLLIAEQQRR CVEALWNYLQ NARELQIVTV GAAAATRAAG QAARGGGGVN ANANAAPGGQ  600
PGAGAGAGAG GGGGPNSKSS DLTAVHAAVG GDGGGGRAHG GNSLAGIPLP GDASVDETVM  660
NWGVTLEMLQ QHFSKHLKQA AKDLGVGSTT LKRICRRYGI TRWPRRSLKS KQGKLQQALK  720
SLYTADGAAA PGERSQGGGD SSAHGGGGAS AMSLGTRDSF MTDPASGGDG ANDASVHGPN  780
GGVGWGLGGS LPPGGLSPLT RHDSITSSPL SGRAPWPPVG GIAGGSTLSG LKRALAADQN  840
PWGGGDGGMP RPGNAGGWPG GDGGGIGKFQ RGFSWHGGDV ARRALHNQAA ETETREERTL  900
HGEYAFAQFG GGNANGRAWY PDQGASARPS PALPIPGASH AAQPTNEDFM WNSFDSGTTL  960
ASTQGGSVHG GSLHGGSVHG GSLHGNMGAV AALNAANATH FAAASPPPPS DIDPGNFLMQ  1020
SGPGSPAGRP GGALKDAADA DADARTGTGT ATGPSGGTKT SGDGSGSSFD ADSSGKTSSG  1080
LLSSGRGRGG GAAGAAGPGP GVVFKASRDD GDGGGLLRVR LLGDVTHAAL VDRLALCLRP  1140
LESERGFFKI KYQDDEDEWC LLSKDSDLEE AIAFAKQRRE NAAAAGVATA DLATALGHVR  1200
LKIESGAVGS PALASPTASA WGARDVGPPG TPSAARACGA SDATFTAKIS LGDGDTMRVK  1260
LLPSMSFRDL AARVMEATPM TLTYTDDADE SCDLSGDADL DECRAACASS GTIRVRATFG  1320
GG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003063204.10.0nit2-like protein 1
TrEMBLC1N5R30.0C1N5R3_MICPC; Nit2-like protein 1
STRINGXP_003063204.10.0(Micromonas pusilla)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP547469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.16e-19Nin-like family protein
Publications ? help Back to Top
  1. Worden AZ, et al.
    Green evolution and dynamic adaptations revealed by genomes of the marine picoeukaryotes Micromonas.
    Science, 2009. 324(5924): p. 268-72
    [PMID:19359590]