PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 52944
Common NameMICPUCDRAFT_52944
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas; Micromonas pusilla
Family SBP
Protein Properties Length: 477aa    MW: 47048.1 Da    PI: 6.8824
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
52944genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP40.66.8e-13172248177
            --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
    SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
            +C v++Ce+  +++ +  r +  C  h++a++v+ +++e r Cq C  fh lsefD   ++C +rL++   r r ++
  52944 172 CCLVDNCENPRKQMLQRARMYLTCAEHARAKMVMFKDEECRECQACRTFHPLSEFDGLNKTCETRLSRKKVRYRART 248
            6*******************************************************************999987655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114115.511170247IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.104.6E-14171234IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-11172248IPR004333Transcription factor, SBP-box
PfamPF031101.2E-18173246IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MTRNEPAEDA GAIATTTARG IASDTQRVGL TANAANASEA PISAEDLATA AELFGLRHAQ  60
EAPTGEGERE AASGVAHARA DATIETDTPP STEANAPAPK ATTTRETSGK EGGELAATSA  120
SLGHSSGATT ASLATTSEAT GITNATNATT TTGGTARRGG HGRAHPVKFK GCCLVDNCEN  180
PRKQMLQRAR MYLTCAEHAR AKMVMFKDEE CRECQACRTF HPLSEFDGLN KTCETRLSRK  240
KVRYRARTQS GAVSGGTVGS GGMPPLSGAG SVGAGGGGNA AKRPRVGGYN DGDHTATTPG  300
AALAESPLYW PPYGGAPGGL GTFPGSGPPV SSDAAWIIAE ASAEAFRAAV QRSVANAMGA  360
GAGGAGAAPG SVGGGNGLPG GAHAMGALPG GVHGLPCILG GAPATDALAG IPGGAHGSAV  420
MNLEWMRVNQ LLGMAQQFQA QQGAEGSNGV FPPAPPGPDV GSGGNGSAGA PGCCVM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003063374.10.0predicted protein
TrEMBLC1N5J40.0C1N5J4_MICPC; Predicted protein
STRINGXP_003063374.10.0(Micromonas pusilla)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1069424
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.11e-07squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Worden AZ, et al.
    Green evolution and dynamic adaptations revealed by genomes of the marine picoeukaryotes Micromonas.
    Science, 2009. 324(5924): p. 268-72
    [PMID:19359590]