PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 50253
Common NameMICPUCDRAFT_50253
Organism
Micromonas pusilla CCMP1545
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas; Micromonas pusilla
Family WRKY
Protein Properties Length: 149aa    MW: 16912 Da    PI: 9.9018
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
50253genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY84.88.2e-2767120255
            --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES- CS
   WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYege 55 
            dDgy+WrKYGqK +kgs+fprsYY+Cts++ +++k+ve+sa++pk+ ++tY+++
  50253  67 DDGYRWRKYGQKLIKGSPFPRSYYKCTSENSSMQKHVEQSADNPKLYVVTYHSD 120
            8**************************************************875 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081124.01961123IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.6E-2562120IPR003657WRKY domain
SuperFamilySSF1182903.4E-2262119IPR003657WRKY domain
SMARTSM007742.6E-2666122IPR003657WRKY domain
PfamPF031061.7E-2167119IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:1900150Biological Processregulation of defense response to fungus
GO:1900425Biological Processnegative regulation of defense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MNRDKNKLFV TGYKTSENVK VETPTEPGTA SLKRRRFNVN DTSTQDAGSN VILEYRVVAH  60
TSDIRIDDGY RWRKYGQKLI KGSPFPRSYY KCTSENSSMQ KHVEQSADNP KLYVVTYHSD  120
RSQANVVYAK LKESAPTLSK ITMHGLDE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-21661171768Probable WRKY transcription factor 4
2lex_A5e-21661171768Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Has a positive role in resistance to necrotrophic pathogens (e.g. Botrytis cinerea), but a negative effect on plant resistance to biotrophic pathogens (e.g. Pseudomonas syringae). {ECO:0000269|PubMed:18570649, ECO:0000269|PubMed:22219184}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By biotic and abiotic stresses such as pathogen infection (e.g. Botrytis cinerea and Pseudomonas syringae), salicylic acid (SA), jasmonic acid (JA), ethylene (ACC), liquid infiltration or spraying, and strongly during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756, ECO:0000269|PubMed:18570649}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003054981.11e-108wrky-like transcription factor
SwissprotQ9XI902e-20WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLC1MHM41e-107C1MHM4_MICPC; Wrky-like transcription factor
STRINGXP_003054981.11e-108(Micromonas pusilla)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP4691626
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.17e-23WRKY DNA-binding protein 4
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Worden AZ, et al.
    Green evolution and dynamic adaptations revealed by genomes of the marine picoeukaryotes Micromonas.
    Science, 2009. 324(5924): p. 268-72
    [PMID:19359590]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]